KEGG   Mycoplasma fermentans JER: MFE_03980Help
Entry
MFE_03980         CDS       T01325                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mfr  Mycoplasma fermentans JER
Pathway
mfr00010  Glycolysis / Gluconeogenesis
mfr00030  Pentose phosphate pathway
mfr00051  Fructose and mannose metabolism
mfr00052  Galactose metabolism
mfr00680  Methane metabolism
mfr01100  Metabolic pathways
mfr01110  Biosynthesis of secondary metabolites
mfr01120  Microbial metabolism in diverse environments
mfr01130  Biosynthesis of antibiotics
mfr01200  Carbon metabolism
mfr01230  Biosynthesis of amino acids
mfr03018  RNA degradation
Module
mfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_03980 (pfk)
   00030 Pentose phosphate pathway
    MFE_03980 (pfk)
   00051 Fructose and mannose metabolism
    MFE_03980 (pfk)
   00052 Galactose metabolism
    MFE_03980 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MFE_03980 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MFE_03980 (pfk)
Enzymes [BR:mfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MFE_03980 (pfk)
Protein phosphatases and associated proteins [BR:mfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MFE_03980 (pfk)
Messenger RNA biogenesis [BR:mfr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MFE_03980 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Med25_VWA DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADN68994
Position
466691..467683
Genome map
AA seq 330 aa AA seqDB search
MKKIKRIAILTSGGDAPGMNSAIRAAAKMARSRGIETFLVYEGYKGLVDDNIVPSTKIDL
DFFNSRGGTCIYSARYPQFKDPEIREIAIKNLNKRKIDALIVIGGDGSYAGAQLLHEKGI
KTIGLPGTIDNDIASSDFTIGYDTALNTVVRCIDQIRDTAASHKRIMIIEVMGNNCGDLA
LHTGLATGAEVIATSEYRLDEKEIVKTCVELTTNAKPVRRNITIVVSEKLYNIKQLAKDI
EKATGWETRPNVLGYIQRGGNPSAQERILASLFGIKAVECLLEGKSGVAIGIIDNDIVAS
PIPEALSMINKSKAKVRDKAIKFNELNRLD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaagagaattgctattctaacttcaggtggcgatgctcctggaatgaat
agtgcaattagagcagcagctaaaatggctcgtagtcgtggaattgaaacatttttagta
tatgaaggttacaaaggattagttgatgataatattgtgccttcaacaaaaattgattta
gatttctttaacagtcgtggaggcacttgtatttattcagcaaggtatcctcaatttaaa
gatccagaaattcgtgaaattgctattaaaaatttaaacaaacgtaaaattgatgctttg
atagttattggtggtgatggttcttatgcaggagcacaattattacatgaaaaaggaatt
aaaactattggacttccagggacaattgataatgatatagcttcaagtgattttactatt
ggctatgatacagctttaaatacagttgttagatgtattgaccaaattagagatacagca
gcaagtcataaaagaattatgattattgaagttatgggtaataactgtggtgacttagca
ttacacacaggacttgcaacaggggcagaagttattgcaacaagtgaataccgtcttgat
gaaaaagaaatagttaaaacttgtgttgaattaactacaaatgctaaacctgttagaaga
aatattacaatagttgttagtgaaaaattatataacattaaacaactagctaaagacatt
gaaaaagcaacaggatgagaaactagacctaatgttttaggatacattcaacgtggtggt
aatccttcagctcaagaaagaattctagcttcactttttggaattaaagctgttgaatgt
ttacttgaaggtaaaagcggtgtggctattggaattattgataatgatattgttgcttca
ccaatcccagaagcattaagtatgattaataaatctaaagctaaagttagagataaagca
attaaatttaatgaattaaaccgtttagattaa

DBGET integrated database retrieval system