KEGG   Mycoplasma fermentans JER: MFE_06130Help
Entry
MFE_06130         CDS       T01325                                 

Definition
(GenBank) alcohol dehydrogenase (ADH)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mfr  Mycoplasma fermentans JER
Pathway
mfr00010  Glycolysis / Gluconeogenesis
mfr00071  Fatty acid degradation
mfr00625  Chloroalkane and chloroalkene degradation
mfr00626  Naphthalene degradation
mfr01100  Metabolic pathways
mfr01110  Biosynthesis of secondary metabolites
mfr01120  Microbial metabolism in diverse environments
mfr01130  Biosynthesis of antibiotics
mfr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_06130
  Lipid metabolism
   00071 Fatty acid degradation
    MFE_06130
  Amino acid metabolism
   00350 Tyrosine metabolism
    MFE_06130
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MFE_06130
   00626 Naphthalene degradation
    MFE_06130
Enzymes [BR:mfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MFE_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C IGFBP
Motif
Other DBs
NCBI-ProteinID: ADN69194
Position
complement(698019..699158)
Genome map
AA seq 379 aa AA seqDB search
MGMFPWMFYKTLKNYYYFFKEIDFMAKTTMKAFVVEKPKQWSVKEVPIPKPGPKQVLIRM
ETSGVCHTDLHAANYDWLVEPKYPLIPGHEGIGIVEKLGPGCTRLKKGDRVCLAWLHDAC
GLCEWCLQGEETLCPKQNMSAYTFDGSFAEYAIGHEDYVGIVPEGLDLITGAPVVCAGVT
TYKAIKRAKARPGYWMVVIGVGGLGQLAIQYAKAMGYRPIGIDLTDEKCELALKSGAEFA
FNSKKDPNFIQKLIEKTGGGAHAVINTSVATIAGEQGMEMLRRGGRQVLVGLPSKDKLGK
DNIGVSVFWTVLFERELAGSIVGTRLDLQESLQYAAEGKVKSEVTKVIKLEEVSEVFEKL
QKGEFLGRAVIDFGYRGKK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgttcccatgaatgttttataaaacattaaaaaattactattatttttttaag
gagatagattttatggcaaaaacaactatgaaagcttttgttgttgaaaaaccaaaacaa
tgaagtgttaaggaagttccaattccaaaaccagggcctaaacaagttcttattagaatg
gaaacttcaggggtatgccacacagacttacacgctgcaaactatgactgattggtagaa
cctaaatatccattaattccaggacacgaaggtatcggtattgttgaaaaacttggtcca
ggatgtacacgtcttaaaaaaggtgacagagtttgtctagcatgattacatgatgcttgt
ggattatgtgaatgatgtttacaaggtgaagaaacactttgtcctaaacaaaacatgtca
gcttacacatttgatggatcatttgctgaatatgcaattggacacgaagattatgtagga
attgttccagaaggattagatttaattactggagcacctgtagtatgtgctggtgttaca
acctataaggcaattaaaagagctaaagctcgtccaggttactgaatggttgttatcggt
gttggtggacttggccaattagcaattcaatatgctaaagcaatgggatatagacctatt
ggtatcgacttaacagatgaaaaatgcgaattagctttaaaatcaggagcagaatttgca
ttcaactctaagaaagatccaaactttattcaaaaacttattgaaaagactggtggtgga
gctcacgctgtaattaacacatcagttgctacaattgctggtgaacaaggcatggaaatg
cttcgtcgtggaggacgtcaagtattagtaggccttccatcaaaagacaaacttggtaaa
gacaacattggcgtttcagtattctgaacagtattgttcgaaagagaattagctggatca
atcgttggtacaagacttgatttacaagaatcacttcaatatgctgcagaaggaaaagtt
aaatcagaagttacaaaagttattaaactagaagaagtttcagaagtatttgaaaaactt
caaaaaggtgaattcttaggacgtgctgttattgactttggttacagaggaaagaaataa

DBGET integrated database retrieval system