KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0142Help
Entry
MFS40622_0142     CDS       T01175                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00860  Porphyrin and chlorophyll metabolism
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01120  Microbial metabolism in diverse environments
Module
mfs_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mfs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MFS40622_0142
Enzymes [BR:mfs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     MFS40622_0142
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     MFS40622_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sacchrp_dh_NADP NAD_Gly3P_dh_N NAD_binding_10 IlvN TrkA_N tRNA-synt_1_2 NAD_binding_2 AlaDh_PNT_C MSP7_C 2-Hacid_dh Radical_SAM 2-Hacid_dh_C DUF87 Synaptonemal_3 ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ADC68841
UniProt: D3S731
Position
complement(129670..130299)
Genome map
AA seq 209 aa AA seqDB search
MINLLPVLLSFEGKKVAVFGCGSVGKRRAKKILKSGGIVDIYSKEFDEEIKKLKENNKNL
NLIEIDVESLDDEELKNIIMGYDFIVTAINDKINKRIVRLAKELNKFVNSSTKTEGVNFI
IPAYTEVDEVIFSIYTKGKSPLIAKHIRIFVENYLKSTDINMMAYMREFLKETIPKQRDR
EKILKKIFEDKKFREELKRLIEKWENGNH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatttgcttcctgttttgttatcttttgaaggaaaaaaagttgcagtatttggt
tgtggaagtgtaggaaagagaagggctaagaaaatattaaaaagtgggggaattgttgat
atctactctaaggaatttgatgaagaaataaaaaaattaaaagaaaataataaaaaccta
aatttaattgaaattgatgttgaaagcttagacgatgaagagttaaaaaatattataatg
ggctatgatttcatagtaacggccatcaatgataaaattaataaaaggatagttagatta
gctaaagagttaaacaaatttgtaaattcctcaacaaagacagaaggagttaattttatc
atccctgcctatacagaagttgatgaggtaatatttagcatatacacaaaaggaaaaagc
cctttaatagctaagcatataagaatttttgttgaaaactatctaaaatcaactgacata
aatatgatggcatatatgagagagtttttaaaagagacaattcctaaacagagagaccga
gaaaaaatattaaaaaagatttttgaagataagaaatttagagaagaattaaaaagatta
atagagaagtgggaaaatggaaatcattga

DBGET integrated database retrieval system