KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0779Help
Entry
MFS40622_0779     CDS       T01175                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00010  Glycolysis / Gluconeogenesis
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01120  Microbial metabolism in diverse environments
mfs01130  Biosynthesis of antibiotics
mfs01200  Carbon metabolism
mfs01230  Biosynthesis of amino acids
Module
mfs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_0779
Enzymes [BR:mfs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MFS40622_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADC69464
UniProt: D3S3Q0
Position
complement(775580..776611)
Genome map
AA seq 343 aa AA seqDB search
MPAKVLINGYGSIGKRVADAVSMQDDMEVIGVTKTKPDFEARLAVEKGYKLFVAIPDKER
VKLFEDAGIPVEGTVLDIIEEADIVVDGAPKKIGKQNLENIYKPHKVKAILQGGEKAKDV
EDNFNALWSYNRCYGKDYVRVVSCNTTGLCRILYAINSVAEIKKARIVLVRRAADPNDDK
TGPVNAITPNPVTVPSHHGPDVVSVVPEFEGKILTSAVIVPTTLMHMHTLMVEIEGNIGK
DDVLEAIKKTPRIITVKAEEGFSSTAKIIEYGRDLGRLRYDINELVVWEESINVLENEIF
LMQAVHQESIVIPENIDCIRAMLQMEEDNFKSIEKTNKAMGIQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtattaataaatggatatggttcaattgggaagagagtagctgatgca
gtttcaatgcaggatgatatggaagttataggggttacaaagacaaaaccagattttgaa
gcaagattagctgttgagaaaggatacaaattgtttgttgccattccagataaagagaga
gttaaattatttgaagatgcgggaattccagtggaggggacagtattggatattatagaa
gaagcagatattgttgttgatggagctcctaagaaaatcggaaaacaaaacttagaaaac
atctacaaacctcacaaagttaaagctatattgcaagggggagagaaagcaaaagatgtt
gaagacaacttcaacgctttgtggagttataacagatgttatggaaaagattacgtaaga
gttgtttcatgtaacacaacaggtttatgcagaattttatatgctataaactcagttgca
gagataaagaaggcaagaatcgtattagtaagaagggcagctgacccaaatgatgacaaa
acagggccagtaaatgccataactccaaatccagttacagttccttcccatcacggtcct
gacgttgtttcagttgtcccagaatttgaaggaaaaatcttaacatcagcagttatagtt
ccaacaacattaatgcatatgcacactttaatggtagagattgaaggaaatattggtaaa
gatgatgttttagaagctatcaagaaaactccaaggattataactgttaaagctgaagaa
gggtttagttcaacagccaagataatagaatatggaagggatttaggtagattaaggtat
gacataaatgagcttgttgtctgggaagaaagcattaacgttttagagaatgaaatattc
ctaatgcaggcagtccatcaagaaagtattgtaatacctgaaaatattgattgtataaga
gctatgcttcagatggaggaagataacttcaaatcaattgaaaagacaaataaagctatg
ggtattcagtaa

DBGET integrated database retrieval system