KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1071Help
Entry
MFS40622_1071     CDS       T01175                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00010  Glycolysis / Gluconeogenesis
mfs00030  Pentose phosphate pathway
mfs00051  Fructose and mannose metabolism
mfs00680  Methane metabolism
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01120  Microbial metabolism in diverse environments
mfs01130  Biosynthesis of antibiotics
mfs01200  Carbon metabolism
mfs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFS40622_1071
   00030 Pentose phosphate pathway
    MFS40622_1071
   00051 Fructose and mannose metabolism
    MFS40622_1071
  Energy metabolism
   00680 Methane metabolism
    MFS40622_1071
Enzymes [BR:mfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MFS40622_1071
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MFS40622_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ADC69751
UniProt: D3S4I7
Position
complement(1070635..1071795)
Genome map
AA seq 386 aa AA seqDB search
MENNRVTISVIKADVGGLCGHTLAPDELLETCEAVLEEAVDEIILDYYVTRCGDDIDLIM
SHKLGCDNEKVHGLAWRAFEEATKVAKELKLYGAGQDLLADSFSGNVRGMGPGCAEMEFV
ERKSEPIVVFCCDKTDPTAFNYPLFKMFADPFNTAGLVFDPSMISGFKFEVHDVVGHKKV
FLDTPEEMYMLLALIGDYEKYAIKRVYRRRDNEIAAVVSTEKLNYIAGEYVGKDDPVAIV
RAQSGFPAVGEVLEPFANPHFVPGWMRGSHWGPLMPVGEEDATPTRFDGPARIIALGFQV
CDGMLIGPNDLFADKGFDKAREKALEMADIIRRMGPFQPHRLPATMMEYTTVPKVLEALE
DRFIPLEGLELIEEGGITRKDRGDVE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataacagagtaacaatcagtgttataaaggcagatgttggaggtttatgtggg
catacactagctccagatgagttgttagaaacatgtgaggcagttttagaggaggcagtt
gatgagataatattggattattatgttacaagatgtggggatgacattgatttaatcatg
agccataaattaggctgtgataatgagaaagtccatggattggcatggagagcttttgaa
gaagctacaaaagtagctaaagaactaaaattgtatggagctgggcaggatttattggct
gacagcttttcaggaaatgttagagggatggggccaggatgtgcagagatggaatttgtt
gaaagaaagagtgagccaatagttgttttctgctgcgataaaacagatccaacagcattt
aactacccattattcaagatgtttgcagacccattcaacacagctggtttagttttcgac
ccttcaatgatttctggatttaaatttgaagttcatgatgttgttggacataaaaaggtc
tttttagatactccagaagagatgtatatgctcttagctttaattggtgattatgagaag
tatgcaattaagagagtttatagaagaagagataacgagatagctgctgttgtcagcact
gagaaattaaactacatagctggggagtatgttggtaaagatgacccagtagccattgtt
agagctcaaagtggattcccagctgttggagaggttttagagccatttgctaacccacac
tttgttccagggtggatgagaggtagccactgggggccattaatgccagttggagaggaa
gatgcaacacctacaagatttgatgggccagcaagaattattgccctcggattccaagtt
tgtgacggaatgttaatcggccctaacgatttatttgcagataaagggtttgataaggca
agagaaaaagcattggagatggcagacataataagaagaatgggtccattccaaccacac
agattgccagcaacaatgatggaatacacaacagttccaaaggttttagaagcattggag
gatagattcattcctttagaaggtttagaattaattgaagaaggaggaattacaagaaaa
gatagaggagacgtagaataa

DBGET integrated database retrieval system