KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1345Help
Entry
MFS40622_1345     CDS       T01175                                 

Definition
(GenBank) phosphatidylserine decarboxylase related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00564  Glycerophospholipid metabolism
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MFS40622_1345
Enzymes [BR:mfs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     MFS40622_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_M23 RnfC_N Tudor_2
Motif
Other DBs
NCBI-ProteinID: ADC70022
UniProt: D3S5A8
Position
1329170..1329790
Genome map
AA seq 206 aa AA seqDB search
MGKYKKFFAVAVCSLLLFTVYFYRDPDRQITSGNNIILSPADGTVKYIKFYENGNPEVFK
DGNCYVINVSRYFPNGCYIIGIFMSPLDVHVNRAPISGEVVYIKHIDGSFYPAFLEGVEK
INERNIVIIKNDSDYIGVVQIAGFIARRCCLSIKEGDYVEMGQRIGKIKLGSQTAVIIPA
NYNITVKVGERVYAGQTIIAVKRTAN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatataagaaattctttgccgttgctgtttgttctttactattatttactgtt
tatttctatagagacccggataggcaaataacaagtggaaataatataattttgtctcca
gctgatggaactgttaaatatataaaattctatgaaaatggaaacccagaggtttttaaa
gatgggaattgctatgttataaatgtttcaagatatttcccaaatggatgctatattata
ggaatatttatgtctccgttggatgtgcatgtcaatcgagccccaataagtggagaggtt
gtgtatataaagcatattgatggtagcttttatccagcattcttagagggcgtagagaaa
ataaatgaaagaaatatagttataataaaaaatgattccgattatattggagttgttcaa
atagctggatttattgcaaggagatgctgtttgagtataaaagaaggagattatgttgag
atggggcagagaataggaaagataaagcttggttcccaaacagctgtaataattccagct
aactacaatataacagttaaagtaggagagagggtttatgctggacaaacaatcattgca
gttaaaagaacagctaattga

DBGET integrated database retrieval system