KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1654Help
Entry
MFS40622_1654     CDS       T01175                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00260  Glycine, serine and threonine metabolism
mfs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfs01100  Metabolic pathways
mfs01110  Biosynthesis of secondary metabolites
mfs01130  Biosynthesis of antibiotics
mfs01230  Biosynthesis of amino acids
Module
mfs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MFS40622_1654
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MFS40622_1654
Enzymes [BR:mfs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MFS40622_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADC70325
UniProt: D3S661
Position
1606076..1607281
Genome map
AA seq 401 aa AA seqDB search
MKKYKDMYPDENGKFGIYGGKFVPETLMPAIAELEEAFKRFWINNEGNFREEFYALLRDY
VGRPTPLYYAERLSEELGCKVYLKREDLAHLGAHKINNALGQALLAKKMGKKRVIAETGA
GQHGVATAAACAKLGLECVIYMGAKDVERQKLNVFRMELMGAKVIPVFGGSQTLKDAVNE
ALRDWTTNVRTTYYLLGSALGPHPYPMMVREFQRVIGKEIREQILEKEGRLPDVIVACVG
GGSNAIGAFYEFLDDDVELYAVEAGGKGIETGMHGASLCAGEVGVLHGAKIYVKEDEFGQ
IEESYSISAGLDYPGVGPELSFLKDEGRIKAVCVTDDEALEAFQLLCRLEGILPALESSH
ALAYAVKLADKLDKDDIMVINLSGRGDKDVHTVAKALGREI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaatacaaagacatgtatccagatgaaaatggaaaatttggtatttatggaggt
aaatttgttccagaaacattgatgccagctatagctgaattggaagaggcatttaaaaga
ttttggataaacaatgaagggaactttagagaagagttctatgctttattaagagactac
gttgggagacctactcctctatactatgctgagagattgagtgaagaattgggatgtaaa
gtttatttaaagagagaggatttagcccacttaggagctcataaaataaacaatgcctta
gggcaagctttattagctaaaaagatgggtaagaagagggttatagctgaaactggagct
ggacagcatggagtagcaacagcagcagcatgtgcaaagcttggtttggaatgcgttatc
tatatgggagctaaggacgttgagaggcaaaagctaaacgtctttaggatggagttgatg
ggagctaaggttattccagtatttggtggctcacagacattaaaagatgctgtaaatgag
gcgttgagggattggacaaccaacgttagaactacctactacttgcttggctctgctctc
ggccctcatccatatccaatgatggttagagagtttcagagagttattggtaaggagatt
agagagcagatattagagaaagaaggaaggctgccagatgttatcgttgcatgcgttgga
ggaggaagtaatgcaataggggcattttatgagtttttggatgatgatgttgagctttat
gctgttgaggcaggaggtaaagggatagaaacaggtatgcatggagcatcactctgtgct
ggagaagttggagttttgcatggagctaagatttacgttaaagaggatgaatttggacag
atagaagagagttacagcatctcagctggtttggactacccaggagtagggcctgagtta
tcatttttaaaggatgagggaaggattaaggcagtttgtgtaactgatgatgaagcttta
gaggctttccaattactatgtagattagagggtattttgccagcattggaaagctctcat
gccttagcttatgctgttaaattagcagataagttggataaagatgacataatggttatt
aatttgtctggaagaggagataaagacgttcatacagttgctaaggctttagggagagag
atttaa

DBGET integrated database retrieval system