KEGG   Mycolicibacterium fortuitum: XA26_02810Help
Entry
XA26_02810        CDS       T04105                                 

Definition
(GenBank) Arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00633  Nitrotoluene degradation
mft01100  Metabolic pathways
mft01110  Biosynthesis of secondary metabolites
mft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    XA26_02810
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    XA26_02810
Enzymes [BR:mft01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     XA26_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: ALI24147
UniProt: A0A0N9Y4Q6
Position
284640..285479
Genome map
AA seq 279 aa AA seqDB search
MGLDLTAYLDRIGVAGRVSADLDTLRNVVAAHGRSIPFENLDPLLGIPVADLSAEALADK
LITRRRGGYCYEHNGFLGYVLAELGYGVDRLAGRVVWMKEPDAPLPALTHNVLAVTVPGE
AGRFLVDVGFGGQTLSSPIRMQTGAVQQTRHEPYRLTEVPTLGAPVYELAAQVRGHWQPL
YRFTAVPQPRIDLEVGSWYVSTHPGGIFVVGLTAALVTDDARMNLRGRNLAIHRHDGTEK
IRFDTATQVLEALTARFGINLSDLDGVDVEARVAQVLDS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggactggacctcactgcgtacctcgaccggatcggcgttgcgggtcgggtgtcggcc
gatctggacaccctgcgcaacgttgtcgccgcgcacggtcgttcgatcccattcgagaac
ctcgacccactgttgggtatcccggtcgctgacctcagtgcagaggcattggcggacaag
ctgatcacccggcgtcgcggtggctactgctacgagcacaacggcttcctcggctacgtc
ctggctgaactgggatacggcgtcgaccggttggccgggcgcgtggtctggatgaaggaa
cccgatgcgccgttgcccgcgctcacgcacaacgtgctggccgtgacggtccccggagag
gccgggcgcttcctggtcgacgtcggtttcggcgggcagacgttgtcatccccgatccgg
atgcagaccggtgcggtgcagcagacccgccacgagccctaccggctgacggaggtgccc
acgttgggcgcgccggtatacgaactggccgcacaggtcagggggcattggcagccgctg
taccgattcaccgcggttccgcaaccgcgcatcgaccttgaggtcggaagctggtatgtg
tcaacgcatcccggtggcatcttcgtcgtcgggctgaccgcggccctggtcacagacgac
gccaggatgaacctgcgcggccgcaacctcgccatccaccgccacgacggcacggagaag
atccgcttcgacaccgccacgcaggtgctcgaagcgctgaccgcgcggttcgggatcaac
ctgtccgatctcgacggcgtcgacgtcgaggcccgggtggcgcaggtgctggacagctga

DBGET integrated database retrieval system