KEGG   Mycolicibacterium fortuitum: XA26_13200Help
Entry
XA26_13200        CDS       T04105                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    XA26_13200
Enzymes [BR:mft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     XA26_13200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR PEP_mutase Sacchrp_dh_NADP Shikimate_DH F420_oxidored Phosphatase PFK 3HCDH_N NAD_binding_7 NAD_binding_3 Toprim_3
Motif
Other DBs
NCBI-ProteinID: ALI25172
UniProt: A0A0N9XNW2
Position
complement(1365770..1366561)
Genome map
AA seq 263 aa AA seqDB search
MILDRFRLDDKVAIVTGAGRGLGAATALAFAEAGADVVIAARTKSQLDEVAEQVAATGRR
AHVVVADLAHPESTAELAATAVEAFGKLDIVVNNVGGTMPAPLMNTSAKDLRDAFTFNVS
TAHALTCAAVPLMLEHSGGGSIINITSTVGRLAGRGFAAYGTAKAALAHYTRLSALDLCP
RIRVNAIAPGSILTSALDIVASNDALRDPMEKATPLRRLGDPADIAAAAVYLSSPAGSYL
TGKVLEVDGGLNMPNLDLPIPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgattctggacagattccgactggacgacaaggttgcgatcgtcaccggagccggccgc
ggactgggtgccgccacagccctggcattcgcggaagccggtgcggacgtggtcatcgcg
gcccgtaccaagtcgcagctcgacgaagttgccgagcaggtcgccgcgaccgggcgacgg
gcgcacgtcgtggtcgccgatctcgcccacccggagtccacagcagagctcgcggccacc
gccgtggaggcgttcgggaaactagacatcgtcgtcaacaacgtcggcggcaccatgcct
gcgccgctgatgaacacctccgccaaagacctgcgtgacgccttcacgttcaacgtgtcg
acagcgcacgcgctgacctgtgcagccgtaccgctgatgctcgaacattccggcggcggc
agcatcatcaacatcacgtccacggtcggccgactggcggggcgtgggttcgccgcctac
ggcaccgccaaggctgccctggcgcactacacccgactctcggcgctcgacctgtgcccg
cgcatccgcgtcaacgccatagcccccggctcgatcctgacctcggcgctcgacatcgtc
gcctccaacgacgccctgcgagacccgatggagaaggccaccccgctgcgccgcctcggt
gatccggcggacatcgccgctgccgcggtgtatctgtcgtccccggcgggcagctatctg
accggcaaggtgctcgaggtcgacggcggcctcaacatgcccaatcttgacctcccgatc
cctgacctctga

DBGET integrated database retrieval system