KEGG   Mycolicibacterium fortuitum: XA26_14430Help
Entry
XA26_14430        CDS       T04105                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mft00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    XA26_14430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mft03011]
    XA26_14430
Ribosome [BR:mft03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    XA26_14430
  Bacteria
    XA26_14430
  Archaea
    XA26_14430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALI25290
UniProt: A0A0N9Y7L4
Position
1480137..1480553
Genome map
AA seq 138 aa AA seqDB search
MRVSASKARRVIDLVRGKSVEEALDILRWAPQAASEPVAKVIASAAANAQNNEGLDPTTL
VVATVYADEGPTAKRIRPRAQGRAFRIRKRTSHITVIVESRPPKQKGAAAASARSRRAQG
SKAATATKKSAETKGGSE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtctcggccagcaaggcgcgccgcgtcatcgatctggtccgcggcaagagtgtc
gaggaagccctcgacatcttgcggtgggcgccgcaggccgccagcgagccggtcgccaag
gtgatcgccagcgctgccgccaatgcgcagaacaacgaagggctggacccgacgaccctg
gtggtcgccaccgtctacgcagacgagggtccgaccgccaagcgcatccgtccgcgtgcc
caggggcgtgcgttccggattcgcaagcgcaccagccacatcacggtgatcgtagaaagc
cgtccgcccaagcagaagggtgcggccgccgcgtcggcgcgtagccgtcgtgctcagggc
agcaaggccgcgaccgccacgaagaagtctgccgagacgaagggaggctcggagtag

DBGET integrated database retrieval system