KEGG   Mycolicibacterium fortuitum: XA26_21640Help
Entry
XA26_21640        CDS       T04105                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00360  Phenylalanine metabolism
mft00362  Benzoate degradation
mft00621  Dioxin degradation
mft00622  Xylene degradation
mft01100  Metabolic pathways
mft01120  Microbial metabolism in diverse environments
mft01220  Degradation of aromatic compounds
Module
mft_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    XA26_21640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XA26_21640
   00622 Xylene degradation
    XA26_21640
   00621 Dioxin degradation
    XA26_21640
Enzymes [BR:mft01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     XA26_21640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ALI26009
UniProt: A0A0N9XI02
Position
complement(2196872..2197879)
Genome map
AA seq 335 aa AA seqDB search
MIHDLYVSDVTLRDGMHAVRHQYSLHQVTTIAAALDAAGVDSIEVAHGDGLGGSSCVYGF
GAHTDLEWIEAVAAVVRNARVATLLLPGIGSVHNLKDAHRAGATVVRVATHCTEADISAQ
HIAAARDLGMDTVGFLMMSHMATPVKLAGQAKLMESYGATCVYVVDSGGAMTMRDVADRV
DALRDVLSPTTEIGVHAHHNLSLGVANSITAVEHGANRVDASLTGMGAGAGNAPLEVFIA
AAERMGWQHGCDLHALEDAADDIVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAEAAAER
YGVDARSLLEEAGRRGMVGGQEDMLVDIALDLTAS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgacttgtacgtcagcgacgtcacgctgcgcgacggcatgcatgccgtgcgc
caccagtacagcctccaccaggtgaccaccattgccgctgcacttgatgccgccggggtg
gattccatcgaggtcgcccacggcgatggtctcggcggatcgagttgcgtctacggcttc
ggggcacacaccgacctggagtggatcgaagcggtcgccgcggtcgtgcgaaacgcccgc
gtcgccaccctgctgttgcccggtatcggcagcgtgcacaacctcaaggacgcccaccgc
gccggcgctaccgtcgtgcgcgttgccacccactgcaccgaagccgacatatcggcccag
cacatcgcggccgcacgagatctcggcatggacaccgtcggctttctgatgatgagccac
atggccacaccggtgaagctggccgggcaggccaaactgatggaaagctacggggccacc
tgcgtctacgtcgtcgactccggcggcgcgatgaccatgcgcgatgtggccgaccgggtc
gatgcgctgcgtgacgtcctgtcacccaccaccgagatcggcgtccatgcccaccacaat
ctgtcgctgggcgtggccaattcgatcaccgctgtcgagcacggcgccaaccgtgtcgat
gcatcgctgaccggtatgggtgcgggagccggcaacgcgccacttgaggtgttcatcgcg
gctgccgagaggatgggctggcagcacggctgcgacctgcacgcgctcgaggacgctgcc
gatgacatcgtgcggcctctgcaggaccggccggtccgggtggaccgcgaaaccctcacg
ctcggatacgccggcgtgtactcgagcttcctgcgtcacgccgaggccgccgcagaacgc
tacggcgtcgacgcgcgctcattgctcgaagaagcgggccggcggggcatggtcggtggc
caggaggacatgctcgtcgacatcgcgctcgatctcactgcgtcatga

DBGET integrated database retrieval system