KEGG   Mycolicibacterium fortuitum: XA26_23120Help
Entry
XA26_23120        CDS       T04105                                 

Definition
(GenBank) Glycosyl transferase, group 1
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00500  Starch and sucrose metabolism
mft01100  Metabolic pathways
Module
mft_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XA26_23120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mft01003]
    XA26_23120
Enzymes [BR:mft01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     XA26_23120
Glycosyltransferases [BR:mft01003]
 Polysaccharide
  Storage polysaccharide
   XA26_23120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glycogen_syn KR NmrA
Motif
Other DBs
NCBI-ProteinID: ALI26157
UniProt: A0A0N9XI74
Position
complement(2344608..2345849)
Genome map
AA seq 413 aa AA seqDB search
MKILMVSWEYPPVVVGGLGRHVHHLATALAEAGHEIVVLSRRPTDTDPSTHPSTDEVSEG
VRVVAAAQDPHEFEFGTDMMAWTLAMGHSMVRTGLAVKDNSGDRWVPDLVHAHDWLVAHP
AIALAEYFDVPLVSTIHATEAGRHSGWVSGPISRQVHAVESWLVRESDSLITCSASMSDE
ITQLFGPELSEIRVIRNGIDADLWPFAPRRPRQGPPELLYLGRLEYEKGVHDAIAALPRI
RRAHPGTTLTIAGDGTQQQWLVEQARKHKVLKATRFVGRLGHEELLQALQSADAAVLPSH
YEPFGIVALEAAATGTPLVTSNVGGLGEAVIDGQTGMSFAPRDVAGLAAAVRAVLDDPEA
AQRRAIAARERLSADFDWHTVAAETSQVYLAAKRAEREPHPRRPIIEHALPDR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgatggtgtcatgggagtacccacccgtcgtcgtcggcggtctgggccga
cacgtgcaccacctggccaccgcactggccgaagcaggacacgagatcgtggtcctgagc
cgcaggcccaccgacaccgacccgagcacccatccgtcgacagacgaggtcagcgagggc
gtccgcgtggtggccgcagcgcaggatccacacgagttcgagttcggtaccgacatgatg
gcctggaccctggccatggggcactccatggtgcgcaccggccttgccgtcaaagacaat
tcgggtgaccgctgggtccccgacctcgtgcacgcgcacgactggctcgtcgcccatccg
gcgatcgccctggccgagtacttcgacgtaccactggtttccaccatccacgccactgag
gccggccggcattccgggtgggtctcagggccgatcagccgccaggtacacgccgtcgag
tcgtggctggtgcgcgaatccgattcgctgatcacatgttcggcgtccatgagcgacgag
atcacccagctgttcggacccgaactgtccgagatccgggtcatccgcaacgggatcgac
gccgatctctggccgttcgccccccggcgtccccggcagggtcctcccgagttgctctac
ctcggtcgcctggaatacgagaagggcgtgcacgacgcgatcgcggccctcccccgcatc
cggcgcgcacacccgggcaccacgctcaccatcgccggcgacggcacccaacagcagtgg
ctcgtcgagcaggcacgaaagcacaaggtgctcaaggcaacccgattcgtcggacggctc
ggccacgaggagttgctgcaagctctgcagtcggccgacgccgccgtcctgcccagccac
tacgagccgttcggcattgtcgcactggaggccgcggccaccggaacccccctggtgacc
tcgaacgtcggcggcctgggcgaggcggtgatcgacggtcagaccggaatgtcattcgcg
ccaagggatgtggccgggctggccgccgcagtccgtgcggtactggatgatcctgaagcc
gcgcagcggcgggcgatcgcggcacgcgagcggctcagcgcagatttcgactggcacacc
gtggccgccgagaccagccaggtctacctggccgccaaacgggccgaacgggagccacat
ccgcgccggccgatcatcgagcacgcgctgcccgaccgctga

DBGET integrated database retrieval system