KEGG   Mycolicibacterium fortuitum: XA26_25300Help
Entry
XA26_25300        CDS       T04105                                 

Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00790  Folate biosynthesis
mft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XA26_25300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mft04147]
    XA26_25300
Enzymes [BR:mft01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     XA26_25300
Exosome [BR:mft04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XA26_25300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_6 Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ALI26373
UniProt: A0A0N9Y5H3
Position
2562512..2563174
Genome map
AA seq 220 aa AA seqDB search
MNRREISEAVGPLGWRLVLGAIYTEVLVPSMADAAAAAAHAVDAAGPDASGHLCVDIRAD
RAVVRLRTRDAHAVTERDLALAREVSGALAARGFELSTGPGAVQAIEIAIDALDIAAVRP
FWKAVTGYIDEPGNEDLNAGLVDPFGRGPAIWFQQMDSPRPQRNRIHLDIDVPHDAAQAR
VDAALAAGATLLSDRVAPRFWVLADAEGNEACICTWQGRD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccgagaaatctccgaggccgtcggtccgctgggctggcggctggtgctggga
gccatctacaccgaggtactggtcccgtcgatggccgatgccgccgcggccgccgctcat
gccgtcgacgcggccggtccagatgcgtcgggccacctctgcgtagacatccgcgccgat
cgcgccgtggtgcgattgcgcacgcgcgacgcccacgcggtgaccgagcgggacctggct
ctggcccgtgaagtgtccggcgcgctggccgcccgcggcttcgagctctccaccggtcca
ggggccgtccaggccatcgagatcgcgatcgacgccctcgacatcgctgccgtgcgcccg
ttctggaaggccgtaacgggatacatcgatgaaccgggcaacgaggacctcaacgcaggc
ctggtcgatccgttcggccgcggtccggccatctggtttcagcagatggattcccctcgg
ccgcagaggaaccggatccacctcgacatcgacgtcccacacgatgcggcgcaggcccga
gtcgacgcggcgctggccgcaggtgccacattgctcagtgaccgcgtggcaccgcgcttc
tgggtactggccgacgcggagggcaacgaggcctgcatctgtacctggcagggccgtgac
tga

DBGET integrated database retrieval system