KEGG   Mycolicibacterium fortuitum: XA26_33610Help
Entry
XA26_33610        CDS       T04105                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00071  Fatty acid degradation
mft00072  Synthesis and degradation of ketone bodies
mft00280  Valine, leucine and isoleucine degradation
mft00310  Lysine degradation
mft00362  Benzoate degradation
mft00380  Tryptophan metabolism
mft00620  Pyruvate metabolism
mft00630  Glyoxylate and dicarboxylate metabolism
mft00640  Propanoate metabolism
mft00650  Butanoate metabolism
mft00900  Terpenoid backbone biosynthesis
mft01100  Metabolic pathways
mft01110  Biosynthesis of secondary metabolites
mft01120  Microbial metabolism in diverse environments
mft01130  Biosynthesis of antibiotics
mft01200  Carbon metabolism
mft01212  Fatty acid metabolism
mft02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XA26_33610
   00630 Glyoxylate and dicarboxylate metabolism
    XA26_33610
   00640 Propanoate metabolism
    XA26_33610
   00650 Butanoate metabolism
    XA26_33610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XA26_33610
   00072 Synthesis and degradation of ketone bodies
    XA26_33610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XA26_33610
   00310 Lysine degradation
    XA26_33610
   00380 Tryptophan metabolism
    XA26_33610
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XA26_33610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XA26_33610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XA26_33610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mft04147]
    XA26_33610
Enzymes [BR:mft01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XA26_33610
Exosome [BR:mft04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XA26_33610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OB_aCoA_assoc Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ALI27188
UniProt: A0A0N9YAZ7
Position
complement(3419992..3421554)
Genome map
AA seq 520 aa AA seqDB search
MLPGIRLPEFVPVNQRSVRSSRFVVMTVPRTLDPRTPVLIGYGQVNQRGENPDVEPVDLM
VEAAREAADPRVLEVVDSVRIVNLLSWHYRDPGLLLAQRIGAGKAATRYTGVGGNVPQSL
VNEACLDLQGGRAEVVLIAGAETWRTRSRLRSAGAKPDWTRQDDSVPEAPGAHDGVPMAG
EAELRINLDRPAYVYPMFEQALRVAAGESSDEHRRRIGELWSQFSAVAAGNPHAWSREAV
SAEKIWQPGPDNRMISWPYTKLMNSNNMVNQGAVLILTTVEKATYLQIPSDRWVFPYAGT
DSHDTYAIGERDELYRSPAIRIAGRRVLELAGVSADEVDFVDVYSCFPSAVQVAAAEIGL
PLADSSRPLTVTGGLTFAGGPWNNYVSHSIATMAEQLVANPGTRGLITANGGYLTKHSFG
VYGTEPPSHEFRWQDVQSEVDAEPTRQLQVDFTGTGTVESWTTPVGRDGTAERAFLAVRT
PEDGRTLARIVDESQAAATMAEDIAGAKVRVHADGSATLL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgccggggatccggttacccgaattcgtaccggtcaaccaacgttcggtgcgctcg
tctaggttcgtggtcatgaccgtgcccaggacactcgatccacgaaccccggtactgatc
ggttacggccaggtcaatcagcggggggagaatccggacgtcgagcccgtcgatctcatg
gtcgaggccgctcgggaggctgccgatccgcgggtgctggaggtcgtcgactcggtacgg
atcgtgaacctgctgtcctggcactaccgggatccggggttgttgttggcgcaacgtatc
ggggcaggcaaggcggcgacgcggtacacgggcgtgggtggcaacgttccgcagtcgttg
gtcaacgaggcctgtctggatctgcagggcggacgggccgaggtggtgctgatcgccggc
gccgagacctggcgtacacgaagccggctgcgctcggccggggccaagccggactggacc
cgtcaggacgactcggtgccggaggcgccgggcgcgcatgacggtgtgccgatggccggt
gaggccgagttgcgcatcaatctggaccgtcccgcttacgtgtatccgatgttcgagcag
gcgctgcgtgtcgccgccggcgagagcagcgatgagcaccgcaggcgcatcggtgagttg
tggtcacagttcagtgccgtcgcggcgggcaacccgcacgcctggagccgtgaggcggtg
tccgccgagaagatctggcagccgggcccggacaaccggatgatcagctggccctacacc
aagctgatgaactcgaacaacatggtgaaccaaggtgcggtgctgatcctgacaaccgtc
gagaaggccacctaccttcagattccctccgaccgttgggttttcccgtatgcggggacg
gattcgcacgatacctacgcgatcggcgagcgggacgagctctatcggtccccggcgatc
cggatcgcagggcgccgcgtcctggagttggcgggtgtgagtgccgacgaggtcgatttc
gtcgacgtgtactcatgcttcccgtcggcggtgcaggtggcggcggccgaaatcggtctg
cccctggccgattcgtcgcggccgctgaccgtcaccggtgggctcacgttcgccggtggt
ccgtggaacaactacgtatcccattcgattgccaccatggccgagcaactcgtggccaat
cccgggacccgtgggctcatcaccgccaatggcggttacctgaccaagcacagtttcggg
gtgtacggcaccgagccaccgtctcacgaatttcgttggcaggatgtgcaatccgaggtc
gatgccgagcccacccgccaactgcaggtggacttcaccggcacgggcacggtggaatcc
tggaccacgccggttggtcgcgacggcacggcggagcgggccttcctggcggtgcggacc
ccggaggacggtcgtacgctggcccggatcgtcgacgagtctcaggcggcagcgaccatg
gccgaggacattgccggggcgaaggtgcgggttcacgccgacggcagcgcgaccctcctc
tag

DBGET integrated database retrieval system