KEGG   Mycolicibacterium fortuitum: XA26_40850Help
Entry
XA26_40850        CDS       T04105                                 

Definition
(GenBank) Pyruvate carboxyl transferase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00020  Citrate cycle (TCA cycle)
mft00620  Pyruvate metabolism
mft01100  Metabolic pathways
mft01120  Microbial metabolism in diverse environments
mft01200  Carbon metabolism
mft01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XA26_40850
   00620 Pyruvate metabolism
    XA26_40850
Enzymes [BR:mft01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     XA26_40850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 RnfC_N ATP-grasp ATP-grasp_3 NQRA GCV_H HlyD_D23 ATP-grasp_4 HlyD_3 AstE_AspA
Motif
Other DBs
NCBI-ProteinID: ALI27894
UniProt: A0A0N9XM18
Position
complement(4190707..4194102)
Genome map
AA seq 1131 aa AA seqDB search
MVDKVLVANRGEIAIRAFRAAYELGLATVAVYPYEDRNSQHRLKADESYQIGEKGHPVRA
YLSVDEIIRVALHAGADAIYPGYGFLSENPELARACDQAGIAFVGPSADVLELTGNKARA
IAEARKAGLPVLASSAPSSSVSELLVAAESMSFPVFVKAVAGGGGRGMRRVNDPADLKDA
IEAASREAQSAFGDPTVFLEQAVINPRHIEVQILADTQGNVIHLFERDCSVQRRHQKVIE
LAPAPNLDPELRERICADAVAFARQIGYSCAGTVEFLLDEQGRHVFIECNPRIQVEHTVT
EEITDVDLVSSQLRIADGESLSDLGLTQDALKIRGAALQCRITTEDPSNGFRPDTGRITG
YRSPGGAGVRLDGGTHLGAEVAAHFDSMLVKLTCRGRDFSTAVARARRAVAEFRIRGVST
NIPFLAAVLEDPDFVAGRVTTSFIEERPELLTARGSADRGTRILNYLADVTVNQPHGPRP
SAVYPRDKLPACDLSVAPPSGSKQRLTELGPEGFAAWLRDSRAIGVTDTTFRDAHQSLLA
TRVRTSGLLRVAPYIARTMPQLLSVECWGGATYDVSLRFLKQDPWERLAALREALPNICL
QMLLRGRNTVGYTPYPETVTHAFVDEAAATGVDIFRIFDALNNVDSMRPAIDAVRHTGTT
VAEVAMSYTGDLSNPGESLYTLDYYLRLAEQIVEAGAHVLAIKDMAGLLRAPAAATLVSA
LKSRFDLPVHVHTHDTPGGQLATYVAAWMAGADAVDGAAAPLAGTTSQPALSSIVAAAAH
TEYDTGLSLDAVCDLEPYWEALRRVYMPFDVAASGPPSPTGRVYTHEIPGGQLSNLRQQA
IALGLGGRFEDIEANYAAADRMLGRLVKVTPSSKVVGDLALAMVGAGIDADDFAANPARY
DIPDSVIGFLRGELGDPAGGWPEPLRTKALDGRGPAKPIQELSAEDETMLAAPGPKRQAT
LNRLLFPGPTADFEAHRDEYGDTSRLSANQFFYGLRHGEEHRVKLEPGVELLIGLEAISE
PDERGMRTVMCILNGQLRPIVVRDRSIASEVPVAEKADRTNPAHIGAPFAGVVTVNVAEG
DAVEAGQSIATIEAMKMEAAITAPESGTVTRIAVARTAQVEGGDLLVVVGQ
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaggttctggtcgccaaccggggagagatcgcaatccgcgcttttcgtgcg
gcgtacgagctcggtctcgcaacggtcgcggtctatccatacgaggaccgtaattctcag
caccggctgaaggccgacgagtcgtatcagataggtgaaaaagggcatccggtccgggcc
tatctttcggtcgacgagatcatccgcgtggctctgcacgcgggcgccgatgcgatctat
cccggctatgggtttctctcggagaaccccgagctggcccgggcatgcgatcaggccggt
atcgcgtttgtggggccttcggccgacgtgctggagctgaccggcaacaaggcccgcgcc
atcgccgaggcccgcaaggccggacttccggtgctggcatcgtcggccccgtcgagttcg
gtctccgaactgctggtcgccgccgaatcgatgagtttcccggtgttcgtcaaggccgtc
gccggtggcggcggccgggggatgcggcgcgtcaatgacccggccgacctgaaggacgcg
atcgaggccgccagccgggaagcgcagtcggcgttcggggatcccacggtgttcctcgag
caggcggtgatcaatccgcgccacatcgaggtgcagatcctggccgacacgcagggcaac
gtgatccacctcttcgagcgcgactgcagtgtgcaacggcgccaccagaaagtcatcgag
ctggcgccggctccgaatctggatcccgaactgcgggagaggatctgcgccgacgcggtg
gcgttcgcccggcagatcgggtactcgtgcgccggtacggtggaattcctgctcgatgag
caggggcggcacgtgttcatcgagtgcaatccccggattcaggtcgagcacacggtgacc
gaggagatcaccgatgtcgacctggtatcgagtcagctgcgcatcgcggacggggagtcg
ctgtccgatctcggactcacccaggacgcgttgaagattcgcggtgctgccctgcagtgc
cgaatcaccaccgaggacccgtcgaacggtttccgacccgacaccggacgcatcaccgga
tatcggtcaccgggcggcgccggcgtccggttggacggtggcacccacctcggggccgag
gtggcggcgcatttcgattcgatgctggtgaagctgacctgccgtggtcgagacttttcg
acggcagtggcgcgggcgcgacgcgcggtcgcggaattccggattcgcggagtatcgacc
aacatcccgttcctggccgcggtcctggaagaccccgacttcgtcgcggggcgggtgacg
acttcgttcatcgaggaacgacccgagctgctcaccgcacgcggcagcgccgaccggggc
accaggatcctcaactatctggccgatgtcaccgtcaaccagccccacggtccacgaccg
tcggcggtgtatccgcgcgacaagctccccgcgtgcgacttgagcgtggccccgccgtcg
ggatccaagcagcgcctgaccgagctggggccggaggggttcgccgcctggttgcgcgac
agccgcgcaatcggcgtcaccgacaccacctttcgcgatgcgcatcagtcgctgctggcg
acccgggtgcgtaccagcggactgctgcgggtcgcgccctacatcgcccgcacgatgccg
cagctgttgtcggtcgagtgttggggtggagcgacctatgacgtctcgctgcggttcctc
aagcaggatccctgggagcgcttggcggcgttgcgtgaggcgctgcccaacatctgtctc
cagatgttgttgcggggtcgcaacacggtgggctacacgccgtatccggagacggtgaca
cacgcgttcgtcgatgaggcggccgccaccggggtggacatcttccggatctttgatgcc
ctcaacaacgttgattcgatgcgcccggccatcgacgcggtccgccacaccggcacgacg
gtcgccgaagtcgcgatgtcctacaccggcgatctgtccaacccaggtgagtcgctctac
acattggactactacctccgcctggccgagcagatcgtcgaggccggagcacatgtgctc
gcgatcaaggacatggccggcctgctgcgggcgcctgcggccgcgacgctggtgtctgct
ctgaaatcgcggttcgacctcccggtgcacgtccacacccatgacacgccgggtgggcaa
ctggcgacctatgttgcggcctggatggccggtgccgacgctgtcgacggcgccgcagcc
ccgttggcgggtacgacaagtcagccggcgctgtcatcgatcgtggccgccgccgcgcac
accgagtacgacaccggcttgtcactcgacgcggtgtgcgacctggagccgtactgggag
gcgttgcgccgtgtctacatgccgttcgatgttgcggcatccggtcctccatctccgacg
gggcgggtgtatacgcacgagatcccaggcggtcagctgagcaatcttcgtcagcaggcc
atcgcgctcggtctgggtggccgcttcgaggacatcgaggcgaactacgctgccgcagac
cggatgttgggccggttggtgaaggtcaccccctcgagcaaggtggtgggtgatctggcg
ctggcgatggtcggcgcgggcatcgatgccgacgacttcgccgcgaacccggcccggtac
gacatccccgacagtgtgatcgggttcctgaggggcgaactcggagatccagcgggcggc
tggccggaacccttgcgtaccaaggccctcgatggcaggggcccggccaagccgatccaa
gagttgtccgccgaggacgaaacgatgctggccgcaccggggccgaagcgtcaggcaacc
ctcaaccggctgctgttcccgggccctacagcggatttcgaggcgcatcgcgacgagtac
ggcgatacctcacggctgagcgccaaccagttcttctacggtctgcgccacggcgaggag
caccgggtcaaactcgaacccggtgtcgaactgctgatcgggctggaggcgatctccgaa
cccgatgagcggggaatgcgcacggtgatgtgcatcctcaacggccagttgcggccgatt
gtggtgcgggaccgcagtatcgccagcgaggtccccgttgccgagaaggccgaccggacg
aacccggcccacatcggtgctcccttcgccggggtggtcacggtcaacgtcgccgaaggg
gacgcggtcgaggccggccagtccatcgccaccatcgaggcgatgaaaatggaagcagcc
atcacggcgccggaatccggcaccgtcaccagaatcgcggtcgcccggaccgcgcaagtc
gaaggtggcgacctcctcgtcgtcgtcggtcagtag

DBGET integrated database retrieval system