KEGG   Mycolicibacterium fortuitum: XA26_44400Help
Entry
XA26_44400        CDS       T04105                                 

Definition
(GenBank) Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    XA26_44400
Enzymes [BR:mft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     XA26_44400
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     XA26_44400
    1.1.1.-  
     XA26_44400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_3 ADH_N_assoc NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ALI28240
UniProt: A0A0N9YEM6
Position
complement(4556321..4557364)
Genome map
AA seq 347 aa AA seqDB search
MYYGPNKVEVADVPEPDPTPGTVKIKVGFNGICGTDLHEYYAGPIFVPTEPHPLTGSQLP
LTMGHEFSGTITELGAGVTGYAVGDRVAVEPIYRCGRCAPCRAGTYNICRQIGFHGLMCD
GGMAEYTVVPADMLHRLPDNVSLELGALVEPMSVAYHAATLGEVGPMHTAVIFGAGPIGI
GLWFALRGKGLDEVFVVEPSETRRSAIESLGARTLDPAAIDVPGFIADRTDGRGADAAFD
AAGVAPAIAAATACVGARKPTISVAIYEKPLATPLLNLVMNESRIQGSLCYTSADFEAVI
DLMAQGRYDTRGWVTPIGIDDVIDEGFEALHAGKKMKVLVNPNGGPS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgtactacgggccgaacaaggtcgaggtcgccgatgtcccagagcctgacccaactccc
ggcaccgtcaagatcaaagtcggattcaacggcatctgtggcactgacctgcatgaatac
tatgccggaccgatcttcgtcccgaccgagccgcatccgctgaccggaagccagctgccg
ctgacgatgggccacgagttctcggggaccatcaccgaactcggtgccggtgtcacggga
tatgcggtcggcgaccgggtggcggtcgagcccatctaccggtgcggacgttgcgcgccg
tgccgcgcaggtacgtacaacatctgccgacagatcggtttccacggcctgatgtgcgac
ggcggtatggccgagtacaccgtcgtcccggccgacatgttgcaccgattgcctgacaac
gtgtctctggagttgggcgcactggtcgaaccgatgtcggtggcctaccacgccgcgacc
ttgggggaggtcggtccgatgcacaccgcggtgatcttcggagccgggccgatcggcatc
ggtctctggtttgcgctgcgcggtaaagggctcgacgaggtgttcgtcgtggaaccgtcc
gagacccggcggagcgcgatcgagtccctcggggccaggaccttggacccggcagccatc
gacgttcccggcttcatcgccgaccggaccgacggccggggtgccgacgccgcgttcgac
gctgcgggggtggcgccggcgattgccgcagccacggcgtgtgtcggtgcgcgcaagccg
acgatcagtgtcgcgatctatgaaaagcctctggccacaccactgctcaacctcgtgatg
aacgagtcccggatccaggggtcgctctgctacacctcggcggacttcgaggcggtcatc
gatctgatggcgcaggggcggtacgacacacgtggctgggtgacgccgatcggaatcgac
gacgtgatcgacgagggcttcgaggccctacatgccggaaagaagatgaaggtgctggtc
aacccgaacggcggtccgtcgtga

DBGET integrated database retrieval system