KEGG   Mycolicibacterium fortuitum: XA26_45230Help
Entry
XA26_45230        CDS       T04105                                 

Definition
(GenBank) Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00250  Alanine, aspartate and glutamate metabolism
mft00330  Arginine and proline metabolism
mft01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XA26_45230
   00330 Arginine and proline metabolism
    XA26_45230
Enzymes [BR:mft01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     XA26_45230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALI28323
UniProt: A0A0N9YET4
Position
complement(4641711..4643339)
Genome map
AA seq 542 aa AA seqDB search
MDAITAVPAPANEPVHDYAPGSGERARLATALGELTGAPIDLPHVIGGKHTMGGGARIDV
VQPHRHNAKLGTLTNAEHADASAAIEAALAAKAEWARMPFDERAAVFLRAADLLSGPWRE
KIAAATMLGQSKTAYQAEIDAPCELIDFWRFNVEFARQILAQQPISSPGVWNRTDHRPLE
GFVYAITPFNFTAIAGNLPTAPALMGNTVVWKPSPTQTFAAYLTMQLLEAAGLPPGVINL
VTGDGIAVSDVALADPRLAGIHFTGSTATFQHLWREVGANIGNYHTYPRLVGETGGKDFV
VAHSSARPDVLRTALIRGAFDYQGQKCSAASRAFVPRSVWHRMGDDFLSATSDLKYGDVT
DLTNYGGAVIDERAYAKNVAAIERAKGAAGVTIAAGGEYDDNEGYFVRPTVLLSDDPTDE
AFSTEYFGPILAVHVYPDADYERILDVVDTGARYALTGAVIADDRAAVHTAADRLRNAAG
NFYINDKPTGAVVGQQPFGGSRASGTNDKAGSALNLLRWTSARSIKETFVPPTKHTYPHM
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaccgccgtgcccgcgccggccaacgagccggtccacgactacgcaccg
ggctcgggcgaacgcgcccggctcgccactgcgctcggcgaactcaccggcgccccgatc
gacctgccgcacgtcatcggcggcaaacacaccatgggcggcggtgcacgcatcgatgtc
gtgcaaccgcatcgtcacaacgcgaagctgggcaccctgaccaacgccgaacacgccgac
gccagtgccgccatcgaggccgcgctggccgccaaggccgagtgggcccggatgccgttc
gacgagcgcgccgcggtgttcctgcgcgcggccgatctgctgtccggaccttggcgcgag
aagatcgccgccgccaccatgctcggccagtccaagaccgcctaccaggccgagatcgac
gccccctgcgagctgatcgacttctggcggttcaacgtcgagttcgcccgtcagatcctg
gcgcaacagcccatcagcagccccggcgtctggaaccgcaccgaccaccggccactcgag
ggcttcgtctacgccatcacccccttcaacttcaccgcgatcgcaggcaacctgcccacc
gcacccgccctgatgggcaacaccgtggtgtggaaaccctcgcccacccagaccttcgcg
gcctacctgacgatgcaactgctcgaggccgccggactgccgcccggggtgatcaatctg
gtgaccggcgacgggatcgcggtttccgatgtggccctggcggatccgcgactggccggc
atccacttcaccggatcgaccgccacgttccagcacctgtggcgcgaagtcggcgcgaac
atcggcaactaccacacctatccacgactggtcggcgagaccggcggcaaggacttcgtc
gtcgcgcactcctcggcccgcccggatgtcctgcgcaccgccctgatccgcggcgccttc
gactaccagggacagaagtgctcggcagcctcccgggccttcgtcccgcgctcggtgtgg
caccggatgggcgacgactttctctcggccacatcggacctcaagtacggcgacgtcacc
gacctgaccaactacggcggtgcggtgatcgacgaacgcgcctacgccaagaacgtcgcg
gcgatcgaacgagccaagggtgccgcaggtgtcaccatcgccgccggcggtgaatatgac
gacaatgaaggctatttcgtgcggcccaccgtgctgctctccgatgacccgaccgacgag
gcgttctccaccgagtacttcggccccatcctggccgtgcacgtctaccccgacgcggac
tacgagcgcatcctcgacgtcgtcgataccggcgcccgctacgccctgaccggcgcggtg
atcgccgacgaccgcgccgcagtgcacaccgccgccgaccggctgcggaacgccgctggc
aacttctacatcaacgacaagccgaccggtgccgtcgtcgggcagcaacccttcggcgga
tcccgggcctcgggcaccaacgacaaggccggctccgctttgaacctgctgcgctggacc
tcggcccgctccatcaaggagacgttcgtgccgcccaccaagcacacctacccccacatg
gaggcctga

DBGET integrated database retrieval system