KEGG   Mycolicibacterium fortuitum: XA26_46570Help
Entry
XA26_46570        CDS       T04105                                 

Definition
(GenBank) putative CHOLESTEROL DEHYDROGENASE
  KO
K16045  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00984  Steroid degradation
mft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    XA26_46570
Enzymes [BR:mft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     XA26_46570
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     XA26_46570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind NAD_binding_4 NmrA KR Polysacc_synt_2 adh_short NAD_binding_2 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ALI28457
UniProt: A0A0N9YFF6
Position
4774658..4775752
Genome map
AA seq 364 aa AA seqDB search
MGDASLTTDLGRVLVTGGSGFVGANLVTELLDRGYAVRSFDRAPSPLGDHAGLEVIEGDI
CDKETVAAAVKDIDTVIHTAAIIDLMGGASVTEAYRQRSFAVNVEGTKNLVHASQEAGVK
RFVYTASNSVVMGGQDIVNGDETMPYTTRFNDLYTETKVVAEKFVLAENGKHDMLTCAIR
PSGIWGRGDQTMFRKVFENVLAGHVKVLVGNKNIKLDNSYVHNLIHGFILAGQHLVPGGT
APGQAYFINDGEPINMFEFARPVLAACGRPLPTFYVSGRLVHKVMMAWQWLHFKFALPEP
LIEPLAVERLYLNNYFSIAKAKRDLGYEPLFTTEQAMAECMPYYVEMFHQMESAQKAPAA
AVAR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgcatctttgaccaccgacctcggccgcgttctggtaaccggcggctccggc
ttcgtcggcgccaacctggtaaccgaactgctcgaccgcggatacgcggtgcggtcattc
gaccgcgcaccgtcaccgctgggcgatcacgcgggcctcgaggtcatcgagggcgacatc
tgcgacaaggagaccgtcgccgcagccgtcaaggacatcgacaccgtcatccacaccgca
gccatcatcgacctgatgggcggcgcctcggtcaccgaggcgtaccggcagcgcagcttc
gccgtcaacgtcgaaggcaccaagaacctggtgcacgcgtcccaggaggcgggcgtcaag
cgcttcgtctacaccgcctccaacagcgtggtgatgggcgggcaggacatcgtcaacggc
gacgagaccatgccgtacaccacccgcttcaacgacctctacaccgagaccaaagtcgtg
gcggagaaattcgtgctcgccgagaacggcaagcacgacatgctcacgtgcgcgatccgg
cccagtggcatctggggccgcggtgatcagaccatgttccgcaaggtgttcgagaacgtg
ctggccggacacgtcaaggtgctggtcggcaacaagaacatcaagctggacaactcctac
gtgcacaacctgatccacgggttcatcctggcgggccagcatcttgtccccggcggcacc
gcacccggtcaggcctacttcatcaacgacggcgagcccatcaacatgttcgagttcgcc
cgtcccgtcctcgcggcgtgcggccgtccgctgccgacgttctacgtgtcaggacgcctg
gtgcacaaggtgatgatggcctggcagtggctgcacttcaagttcgccctgcccgagccg
ttgatcgaaccccttgcggtggaacggctttacctcaacaactacttctccatcgccaag
gccaagcgcgacctgggctacgagccgttgttcaccaccgagcaggccatggccgaatgc
atgccctactacgtcgaaatgttccaccagatggagtcggcacagaaggcgcctgcggca
gcggtcgcccgctga

DBGET integrated database retrieval system