KEGG   Mycolicibacterium fortuitum: XA26_49600Help
Entry
XA26_49600        CDS       T04105                                 

Definition
(GenBank) Succinyl-CoA ligase alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00020  Citrate cycle (TCA cycle)
mft00640  Propanoate metabolism
mft00660  C5-Branched dibasic acid metabolism
mft01100  Metabolic pathways
mft01110  Biosynthesis of secondary metabolites
mft01120  Microbial metabolism in diverse environments
mft01130  Biosynthesis of antibiotics
mft01200  Carbon metabolism
Module
mft_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mft_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XA26_49600
   00640 Propanoate metabolism
    XA26_49600
   00660 C5-Branched dibasic acid metabolism
    XA26_49600
Enzymes [BR:mft01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XA26_49600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ALI28755
UniProt: A0A0N9YKS0
Position
complement(5071507..5072406)
Genome map
AA seq 299 aa AA seqDB search
MSIFLNKDSKVIVQGITGGEGTKHTALMLKAGTQVVGGVNARKAGTKVSHKDKDGNDIEL
PVFGSVAEAMKETGADVSIAFVPPAFSKDAIIEAIDAEIPLLVVITEGIPVQDSAYAWAY
NVDKGQKTRIIGPNCPGIITPGESLVGITPNNITGKGPIGLVSKSGTLTYQMMYELRDFG
FSTAIGIGGDPVIGTTHIDAIEAFEKDPETKVIVMIGEIGGDAEERAADYIKANVSKPVV
GYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKKEALEAAGVKVGKTPSETAALARAILEG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatttttctgaacaaggactccaaggtcatcgtccagggcatcaccggcggtgag
ggcaccaagcacaccgcgctgatgctcaaggccggcacccaggtcgtcggcggcgtcaat
gcgcgcaaggccggcaccaaggtcagccacaaggacaaagacggcaacgacatcgagctg
ccggtgttcggctcggtggccgaggccatgaaggagaccggcgcggacgtgtcgatcgcc
ttcgtgccgccggccttctccaaggacgccatcatcgaggccatcgacgccgagatcccg
ctgctggtggtcatcaccgagggaatcccggtgcaggacagcgcttatgcctgggcctac
aacgtcgacaagggtcagaagacccgcatcatcggccccaactgcccgggcatcatcact
cccggtgagtcgctggtcggcatcacgccgaacaacatcaccggcaagggcccgatcggt
ctggtgtcgaagtcgggcactctgacctaccagatgatgtacgagctgcgcgatttcggc
ttctcgaccgccatcggcatcggcggcgacccggtcatcggcaccacccacatcgacgcc
atcgaggcgttcgagaaggatcccgagaccaaggtcatcgtaatgatcggtgagatcggt
ggcgacgccgaagagcgtgctgccgactacatcaaggccaatgtcagcaagccggtcgtc
ggctacgtcgcgggcttcaccgctccggagggcaagaccatgggccacgccggcgccatc
gtgtcgggctcgtcgggcaccgccgcggccaagaaggaagccctcgaggccgccggtgtg
aaggtcggcaagacgccgtccgagaccgccgcactggcccgggcgatcctcgagggctga

DBGET integrated database retrieval system