KEGG   Mycolicibacterium fortuitum: XA26_49830Help
Entry
XA26_49830        CDS       T04105                                 

Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mft00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    XA26_49830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mft03400]
    XA26_49830
Enzymes [BR:mft01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XA26_49830
DNA repair and recombination proteins [BR:mft03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XA26_49830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 AAA_22 UvrD-helicase SH3_13 PhoH AAA_16 AAA_28 T2SSE NTPase_1 Mg_chelatase UvrD_C AAA_5 SRP54 CbiA AAA_33 AAA_29 NACHT ATPase AAA_23 AAA
Motif
Other DBs
NCBI-ProteinID: ALI28778
UniProt: A0A0N9YKU1
Position
5100937..5102586
Genome map
AA seq 549 aa AA seqDB search
MLDAFAEILEPADVQVAQRLSTLSGTTDASVTLALALAVRALRGGSVCVDLRSVAEQTQL
PELPWPAVDEWLAAVAASPLLGTPPVLRLFGDLLYLDRYWLEEQQVCDDVLTLVATKPGG
SIPDVTRLFPPGFEEQRAAAKVALSQGLTVLTGGPGTGKTTTVARLLALLAEQAALAGHP
PLRIALAAPTGKAAARLQEAVQLEVDRLDAVDRDRISGLQATTLHRLLGSRPDTSSRFRH
HRGNRLPHDVIVVDETSMVSLTMMARLLEAVRPQTRLLLVGDPDQLASVEAGAVLADLVD
GLGSRGVAALQTSHRFGESIGALASAIRAGDASGAVEVLAAGGEHVEWVSSQADERLREV
LVPHALALRQAAVLGDAGTALDILDEHRLLCAHRSGPFGVAQWNRQVQRWLAEATGEPTW
ATWYVGRPILVTANDYGLKLYNGDTGVTVATPDGLRAVVGGSGTFATGRLTEVETMHAMT
IHKSQGSQADEVTVLLPPEESRLLTRELFYTAVTRAKTRVRVVGSEAEIRAAIARQAARA
TGLRKRLKL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgttcgccgagatcctggagcccgccgatgtccaagtggcccaacggttg
agcaccttgtccgggaccaccgacgcatcggtcactctggctctggcgttggcggtgcgg
gccctgcgcggcggttcggtgtgtgtggatctgcggtccgtggccgagcagacccagctg
cccgagctgccatggcccgccgtcgatgagtggctggcggccgtggcggccagcccattg
ctgggcactcccccggtactgcgactattcggcgatctgctgtacctcgaccggtactgg
ttggaggaacagcaggtgtgcgacgacgtgctgacgctggtcgccaccaaaccgggtggc
tcgatcccggacgtgacccggctgttcccaccgggtttcgaagaacagcgggcagctgcg
aaggtggcgttgtcgcagggcctcacagtgctcacgggcggtccgggcaccggcaagacg
accacggtggcgcgcctgttggcgctgctggccgaacaggccgcgctggccggtcacccg
ccactgcgtatcgcactggccgcacccaccggcaaggccgccgcccgactgcaggaggcg
gtgcagcttgaggtggaccggctcgacgcggtggaccgtgaccggatctccggcctgcag
gccaccacgttgcaccggcttctggggtcacgcccggacacgtcgtcccggttccggcat
catcgggggaatcgtctgccgcacgacgtgatcgtcgtcgacgagacgtcgatggtgtcg
ctgaccatgatggcccgattgttggaggcggtgcggccgcaaacccgcctgctgctcgtc
ggcgatcccgatcagctcgcctcggtggaagccggtgcggtgttggccgatctggtcgac
gggctgggatcacgtggggtcgcggcgctgcaaacctcgcaccggttcggcgagtcgatc
ggtgcgctggcctcagcaattcgggccggggacgcctcgggtgcggtcgaggtgctggcg
gccggcggtgagcacgtcgagtgggtatcctcgcaggccgatgagcgactgcgggaagtg
cttgtgccgcatgctcttgcgctgcgccaggcggcggtcctgggggatgccggtacggca
cttgacattctcgacgagcaccggttgttgtgtgcgcatcggagcggtccgttcggtgtc
gcgcagtggaaccgtcaagtgcagcgttggctggccgaggcgaccggagaaccgacctgg
gcaacgtggtacgtcggacggcccattctggtgaccgccaacgattatgggctcaagctc
tacaacggcgataccggcgtcaccgtcgctaccccggacgggctgcgtgccgtggtgggt
ggttcgggaacgttcgcgacgggccggctcaccgaggtggagaccatgcacgccatgacg
atccacaagtctcagggcagccaggctgacgaggtgaccgtgctgctaccacccgaggaa
tcgcgcttgttgacgcgtgagttgttctacaccgcggtcacccgggccaagacgcgcgtt
cgcgtcgtcgggtccgaagcggagatccgcgcagctatcgcccggcaggcagcccgtgcg
accggcctgcgaaagcggctgaagctctaa

DBGET integrated database retrieval system