KEGG   Myxococcus fulvus: LILAB_01255Help
Entry
LILAB_01255       CDS       T01558                                 

Definition
(GenBank) GMC family oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
mfu  Myxococcus fulvus
Pathway
mfu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    LILAB_01255
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     LILAB_01255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N NAD_binding_8 DAO FAD_binding_2 Pyr_redox Pyr_redox_2 FAD_binding_3 Fer4_6 Fer4_9 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AEI62183
UniProt: F8CB78
Position
complement(295403..297700)
Genome map
AA seq 765 aa AA seqDB search
MVVVGSGYGGAITASRLARAGQQVCVLERGRELLPGDYPRTDAEFMSELQVHFDPEAAAD
VGSPTALFELHRGGDVSVVTGCGLGGTSLINANVAMRPDPRVFLDTRWPDAFRADVDGLL
EDGFAWAEHMLRPLPYPEAAPPLATLAALARSAEKLGGTFRRPPLTVTFEEGVNAAGVRQ
GACTLCGDCMTGCNFGAKNSVLMNYLPDAHRHGAKLFTEVGVRYLARDGARWRVYYRPMN
AGRERFDAPDLWLTADRVILAAGTLGTAEILLRSKALGLPLSGQLGQRFSNNGDVMAFGY
NTDVPVHGVGLGEAPAAGREPVGPTISGIIDDRATLRQEDGMVIENGAIPAALARPVTAL
LAAASALAGQDTDRGVIDRVEELARIADSAVRGPYHGAMRNTQTFLVMSHDDGAGQLRLS
GDRVRVDWPDAGRQAVFTRVDERLRRATEALGGTFVRNPLWSKLTGHELLCTHPLGGCAM
GERAEEGVVDHEGRVFAGPEGTEVHEGLYVSDGSVIPRPLGINPLLTISAVAERTVALMA
RRHGWSVDYSPVPEAPGPKPARPLAVQFTETMYGYISAGADEDFLRAGDPARRDTSPFRF
IVTVDTRDLEATLAHPLHPMQLSGSVVAPVLSSRPMTVEHGVLHLMTHEGARPGGRRMRY
QLPLVSESGERFFVDGYKDVHDDDGPDLWVDTTRLLVSIFHGEDASGPCIARGYLRLNAK
DFAVQLSTLRVLHAQGTVQRLAALARFGRFFFGELFETYVRSKAA
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtggtgggctcggggtacggaggggccatcaccgccagccgcctggcgcgcgcg
ggccagcaggtctgtgtcctggagcgaggccgggagctgctgcccggtgactacccgcgc
acggacgccgagttcatgtccgagctccaggtgcacttcgaccccgaggccgcggccgac
gtgggcagcccgacggccttgttcgagctccaccggggcggggacgtctccgtcgtcacg
ggctgcggcctgggcgggacgtcgctcatcaacgccaacgtggccatgcggccggacccc
cgcgtgttcctggacacgcgttggccggacgcgttccgcgccgacgtggacggcttgctg
gaggacggcttcgcctgggccgagcacatgctgcggccgctgccctatccggaggccgcg
ccgccgctggccacgttggcggcgctggcgcggtccgcggagaagctgggcggcacgttc
cgccggccgccattgactgtcaccttcgaggagggcgtcaacgccgcgggggtgcgtcag
ggcgcctgcacgttgtgcggtgactgcatgacgggctgcaacttcggcgcgaagaactcc
gtgctgatgaactacctgccggacgcgcaccgccatggggcgaagctcttcaccgaggtg
ggcgtgcgctacctggcgcgcgatggagcccggtggcgcgtgtactaccggccgatgaac
gcgggccgcgagcgcttcgatgcgccggacctgtggctgaccgccgaccgcgtcatcctg
gcggcggggaccctgggcacggcggaaatcctgctgcgttcgaaggcgctggggctgccg
ctctccgggcagcttgggcagcgcttcagcaacaacggggacgtgatggcctttggctac
aacacggacgtccctgtccatggcgtggggctgggggaggcgcccgccgcgggccgcgag
cccgtgggccccaccatcagcggcatcatcgatgaccgggccacgctgcggcaggaggac
ggcatggtcatcgagaacggcgccattcccgccgcgctcgcgcggcccgtgacggcgctc
ctggccgcggcgtcggccctcgcgggccaggacacggaccggggcgtcatcgaccgggtg
gaggagctggcgcgcatcgcggacagcgcggtgcgcgggccgtaccacggggccatgcgc
aacacgcagacgttcctcgtgatgtcccatgatgacggcgcgggacaactgcggctgtcg
ggggaccgggtccgcgtcgactggccggacgcgggccggcaggccgtcttcacgcgggtg
gatgaacgcctgcgccgcgcgaccgaagccctgggcggaaccttcgtgcgcaacccgctc
tggagcaagctcaccggccacgagctgctgtgcacccatcccctgggcggctgcgccatg
ggggagcgcgcggaagagggcgtggtggaccacgagggccgcgtcttcgcgggccctgaa
ggcacggaggtccacgaggggctctacgtcagcgacggctccgtcattccaaggccgctg
ggcatcaacccgctgctcaccatctccgcggtggcggagcgcaccgtggcgctgatggcc
cggcggcacggctggagcgtggactactcgccggtgccggaggccccgggcccgaagccc
gcgcggcccctggccgtgcagttcaccgagacgatgtacgggtacatctccgccggagcc
gacgaggacttcctgcgggccggggaccccgcgcgccgggacacgtcgcccttccgcttc
atcgtcacggtggacacacgggacctggaggcgacgctggcgcatccgctgcaccccatg
cagttgtcgggcagcgtggtggcgcccgtgctgtcctcccggccgatgacggtggagcac
ggcgtgttgcacctgatgacccacgagggcgcccgccccggaggacggcggatgcgctat
cagcttccgctggtctccgagtccggcgagcgcttcttcgtcgacggctacaaggacgtc
cacgacgacgacgggccggacctgtgggtggacaccacgcggctgctggtgtccatcttc
cacggtgaggacgcctcggggccctgcatcgcccggggctacctgcggctgaacgccaag
gacttcgcggtgcagctctccaccctgcgagtgctccatgcgcaggggacggtgcagcgg
ctggcggcgctcgcccgcttcggacggttcttcttcggggagctcttcgagacctacgtc
cggagcaaggccgcttag

DBGET integrated database retrieval system