KEGG   Myxococcus fulvus: LILAB_02010Help
Entry
LILAB_02010       CDS       T01558                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00330  Arginine and proline metabolism
mfu01100  Metabolic pathways
mfu01130  Biosynthesis of antibiotics
mfu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LILAB_02010
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LILAB_02010
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LILAB_02010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEI62329
UniProt: F8CDX0
Position
complement(475376..476509)
Genome map
AA seq 377 aa AA seqDB search
MSWISTGRTALRAARRVVVKIGTNALTNATGRFNRHHFDALGQDLLWAAQGRELVVVSSG
AIALGVERLGLPSRPRDIPGKQACAAVGQSRLMQAYEEAFAARGKAVAQVLLTHEDVQER
RRYLNVKHTLERLLTAGVVPVINENDTVSVDELKFGDNDTLAGLVAGVVEADALVLLSDV
EGLYTGDPRRDADAELLATVLQVTPEVLALATGTTSGVGTGGMSTKVRAAARASESGIHC
VITSGAVPGRLRAVLEGEDVGTLFEPTGSRRSARAAWIAHALRARGTLTVDAGAREAIVT
GKRSLLPSGVRGVEGDFGRGDPVDLVGVDGAVFARGLAAYDANELRRIAGRHTADIEAVL
GYRYLDEAVHRDDLAVL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgagttggatttccacgggacgcaccgccctgcgcgccgcccggcgggtggtggtgaaa
atcggcaccaacgcgctgacgaacgccaccgggcgcttcaaccgtcatcacttcgatgcg
ctgggccaggatttgttgtgggccgcgcagggccgcgaattggtggtggtgtccagcggg
gccatcgccctgggggtggagcggctgggcctgccctcgcgccctcgcgacatcccaggc
aagcaggcgtgcgcggcggtgggacagagccggctgatgcaggcctacgaagaggccttc
gccgcgcgcgggaaggcggtggcccaggtgctgctcacccacgaggacgtgcaggagcgc
cgccgctacctcaacgtgaagcacacgctggagcggctgctgaccgcgggcgtcgtgccc
gtcatcaatgagaatgacaccgtctccgtggacgagctgaagttcggcgacaacgacacg
ctggcgggcctggtggcgggcgtggtggaggcggacgcgctcgtcctgctgtcggacgtg
gaggggctctacaccggagacccccgccgcgacgcggacgcggagctgctggccacggtg
ctgcaagtgacgcccgaggtgctggcgctggccacgggcaccaccagcggggtggggacg
ggcggcatgagcaccaaggtgcgggccgccgcgcgcgcgtccgagtccggcatccactgc
gtgatcacgtccggcgccgtgcccggccgcctgcgcgccgtgctggagggcgaggacgtg
ggcaccctcttcgagcccaccggcagccgccgcagcgcccgggccgcgtggattgcccac
gccctgcgcgcacgcgggacgctcacggtggacgcgggcgcgcgcgaggccatcgtcacc
ggcaagcgcagcctgctgcccagcggcgtgcgcggcgtggagggggacttcgggcgcgga
gaccccgtggacctggtgggcgtggacggcgccgtgttcgcccggggcctggccgcctat
gacgccaacgagctgcggcgcatcgccgggcgccacacggcggacatcgaggcggtgctg
ggctaccgctacctggacgaggcggtgcaccgcgacgacttggcggtgctgtag

DBGET integrated database retrieval system