KEGG   Myxococcus fulvus: LILAB_11485Help
Entry
LILAB_11485       CDS       T01558                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00071  Fatty acid degradation
mfu00072  Synthesis and degradation of ketone bodies
mfu00280  Valine, leucine and isoleucine degradation
mfu00310  Lysine degradation
mfu00362  Benzoate degradation
mfu00380  Tryptophan metabolism
mfu00620  Pyruvate metabolism
mfu00630  Glyoxylate and dicarboxylate metabolism
mfu00640  Propanoate metabolism
mfu00650  Butanoate metabolism
mfu00900  Terpenoid backbone biosynthesis
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
mfu01212  Fatty acid metabolism
mfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LILAB_11485
   00630 Glyoxylate and dicarboxylate metabolism
    LILAB_11485
   00640 Propanoate metabolism
    LILAB_11485
   00650 Butanoate metabolism
    LILAB_11485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LILAB_11485
   00072 Synthesis and degradation of ketone bodies
    LILAB_11485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LILAB_11485
   00310 Lysine degradation
    LILAB_11485
   00380 Tryptophan metabolism
    LILAB_11485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LILAB_11485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LILAB_11485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LILAB_11485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mfu04147]
    LILAB_11485
Enzymes [BR:mfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LILAB_11485
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LILAB_11485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEI64208
UniProt: F8CR64
Position
2728846..2730057
Genome map
AA seq 403 aa AA seqDB search
MSQEAFIFDAVRTPRGKGRKGALHGTKPISLLTGLVDALKKRHPNLDPQRIDDVVLGVVS
PVGDQGADIARTLVLAAGLPETVGGVQLNRFCASGLTAVNMAAQQVRSGWEHLVIAGGVE
SMSRVPMGSDGGAWAMDPATNYDTYFVPQGISADLIATIEGFTREDVDRYAARSQELAAK
AWAGGYFKNSVIPVVDQNGLTVLAHDELMRPDSTVASLGKLNPSFAAMGEAGGFDAVALQ
KYHFVERIEHVHTPGNSSGIVDGAALVLIGSEQVGKSLGLTPRARIAAVATSGSDPTIML
TGPIPATQKLLAMAGLSVKDIDLFELNEAFASVVLKYQKELGIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERREARRAVITLCVGGGMGVATLIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaagcattcatcttcgacgccgtccggacccctcgcggcaagggcaggaag
ggcgcgctgcacggcaccaagcccatctccctgctcaccgggctggtggacgcgctcaag
aagcgtcacccgaacctggacccccagcgcatcgacgacgtggtgctcggcgtcgtctcc
ccggtgggggaccagggcgcggacatcgcccgcaccctggtgctggcggcggggctgccg
gagacggtgggcggcgtgcagctcaaccgcttctgcgcgtccggcctcacggcggtgaac
atggccgcgcagcaggtgcgctcgggctgggagcacctggtcatcgcgggcggcgtggag
agcatgtcgcgcgtgcccatgggctcggacggcggcgcctgggccatggacccggccacc
aactacgacacctacttcgtcccgcagggcatctccgcggacctcatcgccacgattgag
ggcttcacgcgcgaggacgtggaccgctacgcggcgcgctcccaggagctggcggccaag
gcgtgggccggcgggtacttcaagaactccgtcatcccggtggtggaccagaacggcctc
accgtgctggcgcatgacgagctgatgcgcccggactccaccgtggcgtcgctcggcaag
ctcaacccgtccttcgccgccatgggcgaggccggcggcttcgacgcggtggccctgcag
aagtaccacttcgtggagcgcatcgagcacgtccacacgccgggcaactcgtcgggcatc
gtggacggcgcggcgctggtgctgattggttcggagcaggtgggcaagtcgctgggcctc
acgccgcgcgcgcgcatcgccgcggtggccacgtccggctcggaccccaccatcatgctc
accggccccattccggccacccagaagctgctggccatggcgggcctgtcggtgaaggac
atcgacctgttcgagctcaacgaggccttcgcctcggtggtgctcaagtaccagaaggag
ctgggcatcccggacgagaagctgaacgtgaacggcggcgccatcgccatggggcacccg
ctgggcgccacgggcgcgatgattctggggaccatggtggacgagctggagcgccgcgag
gcgcgccgcgcggtcatcaccttgtgcgtcggcggtggcatgggcgtggccaccctcatc
gagcgcgtctga

DBGET integrated database retrieval system