KEGG   Myxococcus fulvus: LILAB_11490Help
Entry
LILAB_11490       CDS       T01558                                 

Definition
(GenBank) fatty oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00071  Fatty acid degradation
mfu00280  Valine, leucine and isoleucine degradation
mfu00281  Geraniol degradation
mfu00310  Lysine degradation
mfu00362  Benzoate degradation
mfu00380  Tryptophan metabolism
mfu00410  beta-Alanine metabolism
mfu00640  Propanoate metabolism
mfu00650  Butanoate metabolism
mfu00903  Limonene and pinene degradation
mfu00930  Caprolactam degradation
mfu01040  Biosynthesis of unsaturated fatty acids
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
mfu01212  Fatty acid metabolism
Module
mfu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LILAB_11490
   00650 Butanoate metabolism
    LILAB_11490
  Lipid metabolism
   00071 Fatty acid degradation
    LILAB_11490
   01040 Biosynthesis of unsaturated fatty acids
    LILAB_11490
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LILAB_11490
   00310 Lysine degradation
    LILAB_11490
   00380 Tryptophan metabolism
    LILAB_11490
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LILAB_11490
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LILAB_11490
   00281 Geraniol degradation
    LILAB_11490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LILAB_11490
   00930 Caprolactam degradation
    LILAB_11490
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LILAB_11490
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LILAB_11490
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LILAB_11490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 2-Hacid_dh_C F420_oxidored UDPG_MGDP_dh_N AlaDh_PNT_C NAD_Gly3P_dh_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEI64209
UniProt: F8CR65
Position
2730098..2732275
Genome map
AA seq 725 aa AA seqDB search
MSEQSTIRWDQDADGIVVLTLDDPNQSANTMNAAYLKSMRATVDRLVKEKDSIAGVVLTS
AKKTFFAGGDLKDLLKVRKEDARQSFELGQEIKAQLRALETLGKPVVAAINGAALGGGLE
IALACHHRIVADVKGAQVGLPEVTLGLLPGGGGVVRTVRMLGIVDALMKVLLQGQRYRPQ
EAKEVGLVHEVVDSVDALLPAAKAWVKAHPTAQQPWDVKGYKIPGGTPSHPGLAANLPAF
PANLRKQLKGANMPAPRAIMAVAVESTQVDVDTAFTVESRYFTELVTGQVAKNMIQAFFF
DMQHINSGGGRPKDYPRYTAKKVGVLGAGMMGAGIAYVCAKAGIDVVLKDVSLASAEKGK
QYSVKLVEKAVQRGKSTKEKGDALLARILPTDKAADLKGCDLVIEAVFEDVKLKHQVFQE
VQDVVAPDAVLGSNTSTLPITVLAEGVKRTEDFVGMHFFSPVDKMPLLELIAGKKTSDAT
LAKAIDIAAQIGKTPIVVNDSRGFFTSRVIGTFLNEAIAMVGEGIAPASIEQAGLQAGYP
AAPLSLMDELTLTLPRKIRQETKAAALAEGKPWAEHGSYAVVDALIDQHQRKGRSTGGGF
YDYEDGKRAGLWKGLAQHFTKPGHTIPFEDMKDRMLFAEAIDTVRCFDEGVLRSAADANI
GSILGIGFPAWTGGVAQFINGYEGRTGNGPRGFVARARELAQRYGAHFEPPASLVEKAEK
GELLK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagagcaccatccgctgggaccaggacgccgacggcatcgtcgtcttgacg
ttggatgacccgaaccagtccgcgaacaccatgaacgccgcgtacttgaagtccatgcgc
gcgacggtggaccggctggtcaaggagaaggacagcatcgcaggcgtcgtcctcacctcc
gcgaagaagaccttcttcgccggcggtgacttgaaggacctgctgaaggtccgcaaggag
gacgcgcggcagtccttcgagctgggacaggaaatcaaggcgcagctccgcgcgctggag
acgctgggcaagccggtggtcgcggccatcaacggcgcggcgctgggcggcgggctggag
attgccctggcgtgccaccaccgcatcgtggcggacgtgaagggcgcccaggtgggcctg
ccggaggtgacgctgggcctgctgcccggcggcggcggcgtggtgcgcacggtgcgcatg
ctgggcatcgtggacgcgctgatgaaggtgctgctccagggccagcgctaccgcccgcag
gaggccaaggaggtgggcctggtgcatgaggtggtggactccgtggacgcgctgctgccc
gcggccaaggcgtgggtgaaggcgcatcccaccgcgcagcagccctgggacgtgaagggc
tacaagattccgggcggcacgccgtcgcaccccggcctcgcggcgaacctgccggcgttc
cccgccaacctgcgcaagcagctcaagggcgcgaacatgccggcgcctcgcgccatcatg
gcggtggcggtggagagcacccaggtggacgtggacaccgcgttcaccgtggagtcgcgc
tacttcaccgaactcgtcacggggcaggtcgcgaagaacatgattcaggcgttcttcttc
gacatgcagcacatcaactcgggtggcggccgtcccaaggactacccgcggtacaccgcg
aagaaggtgggcgtgctgggcgcggggatgatgggcgcgggcatcgcctacgtctgcgcc
aaggccggcatcgacgtggtgctcaaggacgtgagcctggcgtcggcggagaagggcaag
cagtactccgtgaagctggtggagaaggccgtccagcggggcaagtccaccaaggagaag
ggggacgcgctgctggcgcgcatcctccccacggacaaggccgccgacctgaaggggtgt
gacctggtcatcgaggccgtgttcgaggacgtgaagctcaagcaccaggtcttccaggag
gtgcaggacgtcgtcgcgccggacgcggtgctcgggtccaacacgtccacgctgcccatc
accgtgctggccgagggcgtgaagcgcacggaggacttcgtgggcatgcacttcttctcc
cccgtggacaagatgccgctgctggagctcatcgcggggaagaagacgagcgacgccacg
ctcgcgaaggccatcgacatcgcggcgcagattgggaagacgcccatcgtcgtcaacgac
agccggggcttcttcaccagccgcgtcattggcaccttcctcaacgaggccatcgccatg
gtgggcgagggcatcgcgcccgcctccatcgagcaggcgggcctccaggcgggctacccc
gccgccccgctcagcttgatggacgagctcacgctgacgctgccgcggaagattcgccag
gagacgaaggccgcggccctggcggagggcaagccctgggcggagcacggcagctacgcc
gtggtggacgcgctcatcgaccagcaccagcgcaagggccgctccacgggcggcggcttc
tacgactacgaggatggcaagcgcgcggggctgtggaagggcctggcgcagcacttcacc
aagcccggccacaccatccccttcgaggacatgaaggaccggatgctgttcgccgaggcc
atcgacacggtgcgctgcttcgacgaaggcgtgctgcgctccgccgcggacgccaacatc
ggctccatcctgggcatcggcttcccggcgtggacgggcggcgtggcccagttcatcaac
ggctacgaggggcggaccggcaacgggccgcggggcttcgtggcgcgcgcgcgcgagctc
gcgcagcgctacggggcgcacttcgagccgccggcctcgctcgtggagaaggccgaaaag
ggcgagctcttgaagtag

DBGET integrated database retrieval system