KEGG   Myxococcus fulvus: LILAB_19110Help
Entry
LILAB_19110       CDS       T01558                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mfu  Myxococcus fulvus
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LILAB_19110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEI65724
UniProt: F8C7X3
Position
complement(4511067..4512092)
Genome map
AA seq 341 aa AA seqDB search
MLLAAVILIVAVALIFDFINGFHDAANSIATVVSTRVLSPNLAVAWAAFFNFVAAFGGGV
HVANTMGKGIINFEMLRAQGPSAVLAVIFSALMGAIVWNLLTWWWGLPSSSSHALAGGMI
GATLPVLGFAGLVGSGIAKIAAFIVLSPLIGMTLGISLMVLSTWVVHRQTPLKVDSWFRK
LQLVSSAIFSYSHGTNDAQKVMGIIAVVLFGTIWKDRPFHIDWWMIISCHAAIALGTFFG
GWRIVRTMGHSLTKLAPIGGFAAETGGGVTIIALAQLGIPVSTTHTITGAIVGVGATKGW
RAVKWGVAGRIIWAWVFTIPAAALTAVVVYGLTQVVVRLAS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctactcgccgccgtcatcctcatcgtcgcggtcgcactcatcttcgacttcatcaat
ggattccacgacgcggcgaactccatcgccaccgtggtctccacccgggtgctgtccccc
aacctggccgtggcctgggccgccttcttcaacttcgtggcggcctttggcgggggcgtc
cacgtggccaacaccatgggcaagggcatcatcaacttcgagatgctccgggcccagggc
cccagcgcggtgctcgccgtcatcttctccgccctcatgggcgccatcgtctggaacctg
ctgacgtggtggtggggcctgccgtcctcgtcgtcgcacgcgctggccggcggcatgatt
ggcgccacgctgccggtgctcggcttcgcgggcctggtgggctccggcatcgcgaagatc
gccgccttcatcgtgctgtcgcccctcatcggcatgacgctgggcatcagcctgatggtg
ctgagcacctgggtggtgcaccggcagacgccgctgaaggtggactcgtggttccgcaag
ctgcagctcgtgtcctccgccatcttctcctacagccacggcaccaatgacgcgcagaag
gtgatgggcatcatcgcggtggtgctcttcggcaccatctggaaggaccggccgttccac
atcgactggtggatgatcatctcctgccacgcggccatcgccctggggaccttcttcggc
ggctggcgcatcgtgcgcaccatgggccacagcctcaccaagctggcgcccatcggcggc
ttcgcggcggagacgggcggcggcgtcaccatcatcgcgctcgcccagctcggcatcccc
gtgtccaccacgcacaccatcaccggcgccatcgtcggcgtgggcgccaccaagggctgg
cgcgcggtgaagtggggcgtcgccggccgcatcatctgggcctgggtgttcaccatcccg
gccgcggcgctgacggcggtggtcgtctacggcctcacccaggtggtcgtccgcctggcg
agctga

DBGET integrated database retrieval system