KEGG   Myxococcus fulvus: LILAB_21430Help
Entry
LILAB_21430       CDS       T01558                                 

Definition
(GenBank) putative hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00072  Synthesis and degradation of ketone bodies
mfu00280  Valine, leucine and isoleucine degradation
mfu00650  Butanoate metabolism
mfu00900  Terpenoid backbone biosynthesis
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LILAB_21430
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LILAB_21430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LILAB_21430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LILAB_21430
Enzymes [BR:mfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     LILAB_21430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AEI66186
UniProt: F8CG17
Position
complement(5063649..5064818)
Genome map
AA seq 389 aa AA seqDB search
MGIAVPATYVELADLALARGVAPGKYVDGLGVTRMCVPLEQEDTVTLAARAARAALESAG
CAPSEVGMLVVGTETAVDHSKPVSSYVQGLLGLSTGCRVFETKHACYGGTAALQMALDWV
RSGSARGKKALIVCSDIARYGVGTPGEPTQGAGAVAMLVSDQPRLITFEAGKTGVYSKDV
MDFWRPLYSKDALVDGHYSVQCYLDALEGAYRAYQAVEADAGGARFYSDRFAALVYHVPY
GKMSRKAHRHLRTLDGDPAPDDSFDRLVGSSLVLPSQVGNIYTGSMYLALASLLGTAQED
LTGRCVGLFSYGSGSCAEFFSGVVQPGAQARVKALGLEALLERRRALSIPEYEDVMRARE
RLDERPAADAPGTGFRYQGTRDHKRIYVS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgccgttccggcgacgtacgtggagttggcggacctggccctggcgcgaggc
gtggcgcctggcaagtacgtggacggcctgggcgtgacgcgcatgtgcgtgccgctggag
caggaggacacggtgacgctggcggcccgcgcggcgcgggcggcgctggagtcggccggg
tgcgcgccgtcggaggtgggcatgctggtggtgggcaccgagacggcggtggaccactcc
aagccggtgtcctcctacgtgcaggggctgctggggctgtccaccggctgccgcgtcttc
gagacgaagcacgcgtgctacggcggcaccgcggcgctgcagatggcgctggactgggtc
cgctcggggagcgcccgcggcaagaaggcgctcatcgtctgctcggacatcgcccgctac
ggcgtggggactccaggggagcccacgcagggcgcgggggcggtggccatgctcgtctcc
gaccagccccggctcatcaccttcgaggctgggaagacgggcgtctactccaaggacgtg
atggacttctggcggccgctctactccaaggacgcgctggtggacggccactactcggtg
cagtgctacctggacgccctggagggcgcctaccgggcctaccaggccgtcgaggcagac
gcgggcggcgcgcgcttctacagcgaccgcttcgccgcgctcgtctaccacgtcccctac
gggaagatgtcccgcaaggcccaccggcacctgcggacgctcgacggcgacccggccccg
gatgacagcttcgaccggctggtgggcagcagcctcgtgctgccctcgcaggtcggcaac
atctacacgggctccatgtacctggcgctggccagcctcctggggaccgcccaggaggac
ctgaccggccggtgcgtggggctcttctcctacggcagcggttcgtgcgccgagttcttc
agcggcgtggtgcagcccggcgcccaggcgcgcgtcaaggccctggggctggaggcgctg
ctggagcggcgccgcgcgctctccatcccggagtacgaggacgtgatgcgcgcgcgcgag
cgcctggacgagcgccccgccgcggacgccccgggcacgggcttccgctaccagggcacg
cgcgaccacaagcgcatctacgtgagctga

DBGET integrated database retrieval system