KEGG   Myxococcus fulvus: LILAB_22945Help
Entry
LILAB_22945       CDS       T01558                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00670  One carbon pool by folate
mfu01100  Metabolic pathways
mfu01120  Microbial metabolism in diverse environments
mfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LILAB_22945
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LILAB_22945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AEI66484
UniProt: F8CLG0
Position
complement(5459446..5460300)
Genome map
AA seq 284 aa AA seqDB search
MNPSDPCFSFEFFPPRTDEGEANLLKALEDLAALQPGFVSVTEGAGGSTRTKTVELVLRI
KQETGIEAMAHLTCGGHTPAELRTVLERLSAAKVDNILVLRGDPPKGQAAFEPAPGGFRY
ASEMVRFIREEDFNFCLGGACYPEGHVETPSRDDDLRHLKAKVDAGLDFVVTQLFFDNAF
YFDFVERARRAGINVPIVPGIMPITNYEQIQRFTRLCGATVPMRLALQLERVKDNPEAMA
QLGVAHATVQCMELLSRGVPGIHFYTLNKSPATRMIVSALRARS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgaatccctccgacccgtgcttctccttcgagttcttcccgccccggacggacgagggc
gaggcgaacctgctcaaggcgctggaggacctggcggccctgcagcccgggttcgtctcc
gtgacggagggcgcgggcgggagcacccggaccaagacggtggagctggtgctgcgcatc
aagcaggagacgggcatcgaggcgatggcccacctgacctgcggcggccacacgccggcg
gagctgcgcaccgtgctggagcggctgtccgccgcgaaggtggacaacatcctggtgctg
cgcggagacccgcccaagggccaggcggccttcgagcccgcgcccgggggcttccgctac
gcgtcggagatggtgcgattcatccgagaagaggatttcaacttctgcctcgggggggcg
tgctatccggagggccacgtggagacgccttcacgtgacgacgacctgcgtcatctcaag
gccaaggtggatgccggcctggacttcgtggtgacgcagctcttcttcgacaacgcgttc
tacttcgacttcgtggagcgggcgcggcgcgcgggcatcaacgtccccatcgtccccggc
atcatgcccatcaccaactacgagcagattcaacgcttcacgcgcctgtgcggagccacc
gtgcccatgcgcctggcgttgcagctcgagcgggtgaaggacaaccccgaggccatggcc
cagctcggcgtggcccatgcgacggtgcagtgcatggagctgctgtcgcgcggcgtgccc
ggcatccacttctacacgctcaacaagtccccggcgacgcggatgatcgtgagcgcactg
cgagcccgttcatga

DBGET integrated database retrieval system