KEGG   Corallococcus macrosporus: LILAB_31960
Entry
LILAB_31960       CDS       T01558                                 

Definition
(GenBank) Rhs element Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
mfu  Corallococcus macrosporus
Pathway
mfu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LILAB_31960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mfu02044]
    LILAB_31960
Secretion system [BR:mfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LILAB_31960
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V
Other DBs
NCBI-ProteinID: AEI68273
UniProt: F8C9J4
Position
7854974..7857238
AA seq 754 aa
MIANAALQANQAEFEFQAGAFTAGELAVLGFEAEETLSQPYAVEVALAARPDVDVDEKAL
LGQDARLTIMLGDGTARFFHGIVSRMSRWDEGSGPERRRYRATVVPRLWTLRHRRKSRIY
QELTVPDIVHKVLDEAKVEHRLALTGTYPKRDYCVQYRESDLDFVARLLEEEGIFYFFEH
GEDAHMMVLGDGASANPAMQGEPKLVFRERSQMVASQEYVHELVSRTEVQPGAVALRDYN
FLRPAQDLGASSEAEGAEAALEIYDYPGRYEEPAPGRNLAKVRLEELRARAETVTGASYS
RRVCVGHSFELAEHPDEAANRKYLPVSVRHLGHQSEALSIEQGSLRSREDYRNEFLCQPA
EVPFRPPRVTPRPVIPGAQTAIVVGPSGEEIHTDEHGRIKVQFHWDREGKSNDKSSCWIR
VSQAWAGPGWGALYLPRIGHEVVVEFLEGDPDRPIVTGSVYNGANPTPIDLPGNKTQSTL
RSSSSPGGAGSNELRFEDAAGSELVYLHAQKDFNIVVENDKTQEVRGNETLLVRKDRSRV
IEGNQALLVKKNDDSTVTGNQTLAVTQNRSTTVGGNHTEAVAGDQSISVSGNQALTVAMA
SAETVALGKMLNVGGALAVTVGAAFNELVGGLKSEQVGGAKVEVVGAKKSETVKGARTLQ
VGGDLSEEVGKSRTLKVDKDMLVSVAGKVNHAAKDAYTLSAKEISLVAQEQFTLKVGSAT
LQVKKNGDVVIKGAKVEVTATGDIVIKGSKISEN
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgatcgcgaacgccgccttgcaagccaaccaggctgagttcgagttccaggcaggggct
ttcacagccggagagctggccgtgctgggcttcgaggccgaggagacgctgtcccagccc
tacgcggtggaggtggcgctggcggcgcggccggacgtggacgtggatgagaaggcgctg
ctgggccaggacgcgcgcctcaccatcatgctcggggacggcaccgcgcgcttcttccac
ggcatcgtgtcgcgcatgtcacgctgggatgaaggcagcggcccggagcgccgccgctac
cgcgccaccgtggtgccgcggctgtggacgctgcgccaccggcgcaagagccgcatctac
caggagctgaccgtcccggacatcgtccacaaggtgctggacgaggccaaggtggagcac
cggctggcgctcaccggcacctaccccaagcgggactactgcgtgcagtaccgcgagtcc
gacctcgacttcgtggcccgcctcctggaagaagaaggcatcttctacttcttcgagcac
ggcgaggacgcccacatgatggtgctgggcgacggcgcctccgccaaccccgcgatgcag
ggcgagcccaagctcgtcttccgcgagcgcagccagatggtcgcctcgcaggagtacgtc
cacgaactggtgtcccgcacggaggtgcagcccggcgccgtggccctgcgcgactacaac
ttcctgcgccccgcccaggacctgggggcctcttccgaggcggagggcgccgaggccgcg
ctcgaaatctacgactaccccggccgctacgaggagcccgcgccgggccgcaacctggcc
aaggtgcgcctggaggagctgcgcgcccgggcggagacggtgacgggcgccagctacagc
cgccgcgtctgcgtgggccactccttcgagctggcggagcacccggacgaggccgccaac
cgcaagtacctgcccgtctccgtgcggcacctgggccaccagtcggaggcgctgagcatc
gagcagggctcgctgcgcagccgcgaggactaccgcaacgagttcctctgccagcccgcg
gaggtccccttccgcccgccgcgcgtgacgccccgccccgtgattcccggcgcgcagacg
gccatcgtggtgggccccagcggcgaggagatccacaccgacgagcacggccgcatcaag
gtccagttccactgggaccgcgagggcaagagcaacgacaagagctcctgctggattcgc
gtcagccaggcctgggcgggcccgggctggggcgcgctgtacctgccgcgcatcggccac
gaggtcgtcgtcgagttcctcgagggagatccggaccggcccatcgtcaccggcagcgtc
tacaacggcgcgaacccgacgcccatcgacctgcccggcaacaagacgcagagcacgctg
cgctccagctccagccccggcggcgcgggctccaacgagctgcgcttcgaggacgcggcc
ggcagcgagctcgtctatctgcacgcgcagaaggacttcaacatcgtcgtggagaacgac
aagacgcaggaggtccgcggcaacgagacgttgctggtgcgcaaggaccgctcccgcgtc
atcgagggcaaccaggccctgctggtgaagaagaacgacgacagcaccgtcaccggcaac
cagacgctggccgtcacgcagaaccgctccaccaccgtgggcggcaaccacaccgaggcg
gtggccggagaccagtccatcagcgtcagcggcaaccaggccctcaccgtggccatggcc
tccgcggagacggtggccctggggaagatgctcaacgtcggcggcgcgctcgccgtcacc
gtgggcgccgccttcaacgagctggtgggcggcctcaagtccgaacaggtgggcggcgcc
aaggtggaggtcgtcggcgccaagaagtccgagacggtcaagggcgcccgcacgctccag
gtgggcggagacctctccgaagaggtgggcaagtcccgcacgctcaaggtggacaaggac
atgctggtcagcgtggccggcaaggtgaaccacgccgccaaggacgcctacaccctgtcc
gccaaggaaatctccctggtggcccaggagcagttcaccctcaaggtcggctccgccacg
ctccaggtgaagaagaacggggacgtggtcatcaagggcgccaaggtcgaggtcaccgcg
acgggcgacatcgtcatcaagggctccaagatttccgagaactag

DBGET integrated database retrieval system