KEGG   Corallococcus macrosporus: LILAB_32005
Entry
LILAB_32005       CDS       T01558                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
mfu  Corallococcus macrosporus
Pathway
mfu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LILAB_32005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mfu02044]
    LILAB_32005
Secretion system [BR:mfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LILAB_32005
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEI68282
UniProt: F8C9K3
Position
7868922..7869413
AA seq 163 aa
MAESVHLYLKANGTDIKGDSTQTSLGRADSIECVAYSQKVFTAREAGSGLATGRRQYEGI
EITKRIDKASPLLMKALCENQVIDATFKFFRPNPTGDGTTEQFYTVSVKKARINAIQQTV
PNSFVPASTNLPPMETVQLVFHTINWTITNGGVTHEDTWDTQR
NT seq 492 nt   +upstreamnt  +downstreamnt
atggctgaatcagtacacctgtacctgaaggcgaacgggacggacatcaagggcgacagc
acgcagaccagcctgggccgcgctgactccatcgagtgcgtggcctacagccagaaggtc
ttcaccgctcgcgaggccggctccggtctggcgacgggccgccgccagtacgagggcatc
gaaatcaccaagcgcatcgacaaggcgtcgccgctgctgatgaaggccctgtgcgagaac
caggtcatcgacgcgaccttcaagttcttccgtcccaacccgacgggcgacggcaccacc
gagcagttctacacggtgtccgtcaagaaggcgcgcatcaacgccatccagcagacggtg
ccgaactccttcgtccccgcgagcaccaacctgcccccgatggagaccgtccagctggtg
ttccacaccatcaactggaccatcaccaacggcggcgtcacgcacgaggacacctgggac
acccagcgttga

DBGET integrated database retrieval system