KEGG   Corallococcus macrosporus: LILAB_32010
Entry
LILAB_32010       CDS       T01558                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
mfu  Corallococcus macrosporus
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mfu02044]
    LILAB_32010
Secretion system [BR:mfu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LILAB_32010
SSDB
Motif
Pfam: GPW_gp25 KapB
Other DBs
NCBI-ProteinID: AEI68283
UniProt: F8C9K4
Position
7869496..7869891
AA seq 131 aa
MGSRGLLSRIAEGNGTLAPPGDVVESIAEHLRSLLNTRKGESVASPGYGILDLNDVVHSY
PSAIPRMTQSIRQAIQEFEPRLKSVVVNYNADPVDPTALRFDITAQLATRDRRGMVRFHT
QVHPGGRVDLW
NT seq 396 nt   +upstreamnt  +downstreamnt
atgggctcccgaggcttgttgtcgcgcatcgctgaaggcaacggcacgctcgccccacct
ggcgacgtcgttgaatccatcgccgagcacctgcgcagcctgctcaacacacgcaagggg
gagtccgtggcgtcgccgggctacggcatcctggacctgaacgacgtcgtccactcctac
ccgtcggcgataccgcggatgacgcagtccatccggcaggccatccaggagttcgagccg
cgcctgaagagcgtggtggtgaattacaacgcggatccggtggacccgacggcgctgcgc
ttcgacatcaccgcccagttggccacccgggaccggcgcggcatggtgcgcttccacacc
caggtgcatccaggcgggcgcgtggacctgtggtga

DBGET integrated database retrieval system