KEGG   Myxococcus fulvus: LILAB_32115Help
Entry
LILAB_32115       CDS       T01558                                 

Definition
(GenBank) ATP-dependent Clp protease, ATP-binding subunit ClpC
  KO
K03696  ATP-dependent Clp protease ATP-binding subunit ClpC
Organism
mfu  Myxococcus fulvus
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mfu03110]
    LILAB_32115
Chaperones and folding catalysts [BR:mfu03110]
 Heat shock proteins
  HSP100
   LILAB_32115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small Clp_N AAA_5 AAA_16 Sigma54_activat TniB AAA_22 ATPase_2 AAA_14 RuvB_N AAA_18 IstB_IS21 AAA_7 Mg_chelatase NACHT ResIII DUF815 AAA_19 AAA_23 Spc7
Motif
Other DBs
NCBI-ProteinID: AEI68304
UniProt: F8C9M5
Position
complement(7899758..7902412)
Genome map
AA seq 884 aa AA seqDB search
MANVCDLCHQRPATTRVTRVAGNRRTTESLCDVCSSQRSRFGRMGLGTSLFDQFFSDFGD
EDFGGLSRSLQQPVERYDITEAFSDETRRVLEGAFEAARGAGAASIDTEHLLVALAKDPL
GRTALSRMKLDPARVAERAESELRRGKRPMERPELSPHAKRALELAYQEAYELGHSYVGP
EHVLLGLLQEGEGLASELLRELGAQHGKARASVAESLAPSSEARRSPTPTLDEYCRDLTS
LASEGKLDPVVGRANEIETTLEILSRRTKNNPVLIGEPGVGKTAIVEGIAQRIISAAVPD
TLRDKRVLQLDLSGLLAGSKYRGEFEERLKKVMDEVKAHSEDIVLFIDEIHTIVGAGAAE
GAMDAGNMLKPSLARGELHVIGATTLDEYRKRIEKDAALERRFQPVVVPEPTAEQAIEIL
RGLKDRYESHHRVRIADQALVAAVELSDRYVTGRFLPDKAIDLVDQAAARVRLRLTLPPE
RLVNAEHEVVKVKRSLAEARDRKAEPRIQELEAKLNAAEREVQSAQKERRTQKSGETPEV
RAEDVAEVLSRMTGIPVTQMTEDERKKLLELESRLHERVIGQDEAIRVLSQAIRRARAGL
KDESRPIGSFLFLGPTGVGKTELAKTLAELLFGDEKALVRFDMSEYMEKHTVSRLVGAPP
GYVGYEEGGQLTEAVRRRPYCVLLFDEVEKAHPDVFHMLLQVLDDGRLTDAQGTVVNFKN
TVIIGTSNLGSHLIQESTARKEPQERLRERVMGVLKGHFPPEFLNRIDETVVFEPLNRAQ
LRAIVDLMLEKTRRMLHSQGIALEVTPAALEALVDKGWDPTFGARPLRREIQRAIEAPLA
ESLIAGDIHENSRVCADFKDGKFRFDEVEAAEPEREQAAASAVH
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtctgcgacctctgccaccagcgcccggcgaccacccgggtcacccgcgtc
gccgggaaccggcggaccacggagtccctgtgtgacgtctgcagcagccagcgctcgcgc
ttcgggcgcatggggttgggcacgtcgctcttcgaccagttcttcagcgacttcggggac
gaggacttcgggggcctgtcgcgctcgctccagcaacccgtggagcgctacgacatcacc
gaggccttctccgatgagacgcggcgcgtgctggagggcgccttcgaggcggcgcgcggc
gcgggcgcggcgtccatcgacaccgagcacctgctggtggcgctcgcgaaggacccgctg
gggcgtacggcgctcagccgcatgaagctggacccggcccgggtcgccgagcgcgccgag
tccgagctgcgccgtggcaagcggcccatggagcgccccgagctttcgccgcatgcgaag
cgggccctggagctcgcgtaccaggaggcctacgagctggggcactcctacgtgggcccc
gagcatgtgctcctgggcctgctccaggaaggggagggcctggcgtcggagctccttcgc
gagctgggggcccagcatggcaaggcccgcgcgtccgtcgcggagtcgctcgccccgtcc
tcggaggcgcggcgctcgcccacgcccacgctggatgagtattgccgagacctcacgagc
ctggcgtcggaggggaagctggacccggtggtgggacgggccaacgaaatcgagaccacg
ctcgaaatcctgtcgcgccgcacgaagaacaacccggtgctcatcggcgagccgggcgtg
ggcaagacggccatcgtggagggcatcgcccagcgcatcatctccgccgccgtcccggac
acgctgcgcgacaagcgcgtgctgcagctcgacctctccggcctgctcgcgggcagcaag
taccgcggcgagttcgaggagcggctgaagaaggtcatggacgaggtgaaggcgcacagc
gaggacatcgtcctcttcatcgacgagattcacaccatcgtcggcgcgggcgcggcggag
ggcgccatggacgcgggcaacatgctcaagccgtcgctggcgcgcggcgagctgcacgtc
atcggcgcgacgacgctggacgagtaccgcaagcgcatcgagaaggacgccgcgctggag
cgccgcttccagccggtggtcgtcccggagcccacggcggagcaggccatcgagatcctg
cgggggctcaaggaccgctacgagtcacaccaccgcgtgcgcatcgcggaccaggccctg
gtcgcggcggtggagttgtcggaccgctacgtcaccggccgcttcctgccggacaaggcc
attgacctggtggaccaggcggcggcgcgcgtgcggctgcggttgacgctgccaccggag
cggctggtgaacgccgagcatgaagtggtgaaggtgaagcgctcgctcgccgaggctcgg
gacaggaaggcggagccgcgcatccaggagctggaggcgaagctgaacgccgccgagcgt
gaggtgcagagcgcgcagaaggagcgccgcacgcagaagtccggtgagacgccggaggtc
cgcgccgaggacgtggcggaggtgctgtcgcgcatgacgggcatccccgtgacgcagatg
acggaggacgagcgaaagaagctcctggagctggagtcccgactgcacgagcgcgtcatc
ggccaggatgaggccatccgcgtgttgtcgcaggccatccggcgggcgagggcggggctc
aaggacgagtcgcggcccatcggctccttcctcttcctgggccccacgggcgtgggcaag
acggagctggcgaagacgctggcggagctgctcttcggcgacgagaaggcgctcgtccgc
ttcgacatgagcgagtacatggagaagcacaccgtgagccggctggtgggcgcgccgccg
ggctacgtgggctacgaggagggcggacagctcacggaggcggtgcggcgcaggccctac
tgcgtgctcctcttcgacgaggtggagaaggcccaccccgacgtgttccacatgctgctc
caggtgctggatgacgggcgactcacggacgcgcagggcacggtggtgaacttcaagaac
accgtcatcatcggcaccagcaacctgggctcgcacctcatccaggagtccaccgcgcgc
aaggagccccaggagcgcctgcgcgagcgcgtcatgggcgtgctcaagggccacttcccg
ccggagttcctcaaccgcatcgatgagaccgtggtcttcgagccgctgaaccgcgcgcag
ctccgcgccatcgtggacctgatgctggagaagacgcgccgcatgctccacagccagggc
atcgcgctggaggtgacgcccgccgcgctggaggccctggtggacaagggttgggatccg
accttcggcgcgcgcccgctgcggcgtgaaatccagcgcgccatcgaagcgccgctcgcg
gagtcgctcatcgctggggacatccatgagaacagccgcgtgtgcgcggatttcaaggac
ggaaaattccggtttgatgaggtggaggccgcggagccggagcgcgagcaggctgcggcg
agcgccgttcactga

DBGET integrated database retrieval system