KEGG   Methanothermus fervidus: Mfer_0032Help
Entry
Mfer_0032         CDS       T01351                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00020  Citrate cycle (TCA cycle)
mfv00640  Propanoate metabolism
mfv00660  C5-Branched dibasic acid metabolism
mfv00720  Carbon fixation pathways in prokaryotes
mfv01100  Metabolic pathways
mfv01110  Biosynthesis of secondary metabolites
mfv01120  Microbial metabolism in diverse environments
mfv01130  Biosynthesis of antibiotics
mfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mfer_0032
   00640 Propanoate metabolism
    Mfer_0032
   00660 C5-Branched dibasic acid metabolism
    Mfer_0032
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0032
Enzymes [BR:mfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mfer_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADP76836
UniProt: E3GWM2
Position
complement(35162..36265)
Genome map
AA seq 367 aa AA seqDB search
MKLYEYNAKKLFKMEGIPIPEGYVAKNPDEVYEASKKINAPVALKAQVLVGGRGKSGGIK
FASSPKNAYDLSKSLFNTKIKGEKVKKILIEEKIDIKEELYISVIIDRAAKKPLIMGSVH
GGVDVEEKVRENSIVKYHVNPLDKFMPYEGREIARKMGLESNLIPKVGNIIWKTYKLFKK
YDAKLVEINPLAITPDNKVIALDAKIDLDYDGVYRHPEIQNLEEYKEREFAFTKLDGDIA
VIGNGAGLTLAAMDIISLYGGKPATFLDIGGGASSEVIEKALNFVSSLSNVKVIFVNILG
GITRADEVAKGIVKASNELDRDIPIVIRLTGTNQRKGHEILKNAGIPFETSLEKAAKKAV
EISNSFK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacgagtacaacgctaaaaaattatttaaaatggaaggaataccaatacca
gaaggttacgtagcaaaaaatcctgatgaagtttatgaagcatctaaaaaaataaatgct
ccagtagctttaaaagcacaggttttggttggtggaagaggtaaatcaggcggtataaaa
tttgcttcatcaccaaaaaatgcctatgatttatctaaatcattatttaataccaaaatt
aaaggagaaaaagtaaaaaaaattttaattgaagaaaaaatagatataaaggaagaattg
tacattagtgtaattattgatcgtgcagctaaaaaacctttaattatgggtagtgttcat
ggtggcgtagatgttgaagaaaaagtaagggagaattctatagtaaaatatcatgtcaat
cctcttgataaattcatgccatatgaaggtagagaaatagcacgtaaaatgggtctagaa
agtaatttgatacccaaggttggaaatatcatatggaaaacttacaaactatttaaaaaa
tatgatgctaaacttgtggaaataaatccattggctataactccagacaacaaagttata
gctctagatgcaaaaattgatttagattatgatggagtttatagacatcctgaaatacaa
aatttagaagaatataaagaaagagaatttgcattcacaaaattagatggagatattgct
gttattggtaatggagctggtttgactttagctgctatggacataataagtttatatggg
ggaaaaccagctacttttcttgatatcggaggaggtgcatcctcagaagtcattgaaaaa
gctttaaattttgtttcatctctttcaaatgttaaagtaatttttgttaatatattaggt
gggataacaagagcagatgaagttgcaaaaggaattgtaaaagcatcaaatgaattagat
agagatataccaattgttatacgtcttacagggactaatcaaagaaaaggacatgaaatt
ttaaaaaatgctggaataccttttgaaacttctcttgaaaaagctgcaaagaaagctgtt
gaaatttcaaatagttttaaatga

DBGET integrated database retrieval system