KEGG   Methanothermus fervidus: Mfer_0590Help
Entry
Mfer_0590         CDS       T01351                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00340  Histidine metabolism
mfv01100  Metabolic pathways
mfv01110  Biosynthesis of secondary metabolites
mfv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mfer_0590
Enzymes [BR:mfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mfer_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADP77389
UniProt: E3GYK7
Position
571765..573057
Genome map
AA seq 430 aa AA seqDB search
MEVVVFKKEKIENLIKRSEIDISTVIPKVSEIIREVKECGDEALINLTRKFDGVEIDKIK
VTKDEIKRSYKRLDDSIIHALKKASKNIKKFHERQIPKEWFINNDIYAGQIIRPIESVGC
YIPGGRAVYPSTALMTIIPAKVAGVKRVVCCTPPQENGFVDDATLVAADIAGADEIYKVG
GVQAIAALAYGTETIRPVNKIVGPGNIFVTAAKKLVYGDVDIDFLAGPSEVLIIADENAK
EEYITAEMLAQAEHDPQASSVLVTNSTKIANNVRSLIKKKIKKYKRREIIEKSLKENGKI
VITKNIRESIDFANKYAPEHLVLMVKNPEKYLKYINNAGSIFLGDNTPVSAGDYGLGSNH
VLPTGGFAKACGGLSTESFIKKITVQKLSKKGLLSLKDIVIPLSEYEGLDGHAKSFKKRL
EVLKSEHDKC
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgttgtgtttaaaaaagaaaaaatagagaatttaataaaaagatctgaaatt
gatataagcactgttataccgaaagttagtgaaataataagggaagtaaaagaatgtggg
gatgaagcactaataaatttaactcgaaagtttgatggagtagaaattgataaaattaaa
gttacaaaagatgaaataaaaagaagttacaaacgattagatgatagcattattcatgca
ttaaaaaaagcttcaaaaaatattaaaaaatttcatgaacgacaaattccaaaagaatgg
tttataaataatgatatttatgctggacaaataattagaccaattgaaagtgtagggtgt
tacataccaggaggtagagctgtatatccatctacagcattgatgacaataattcctgcg
aaagttgcaggagtaaaaagagttgtatgttgtacacctccacaagaaaatggatttgtt
gatgatgcaactttagttgctgcagatattgcaggagcagacgaaatatataaagtgggt
ggagtccaagcgatagctgcactagcttatggtactgaaacaataaggcctgtcaataaa
attgttggaccaggaaacatatttgtcactgctgcaaaaaaacttgtttatggagatgta
gacatagattttcttgctggaccttcagaggttttaataattgctgatgaaaatgctaaa
gaagaatacattactgctgaaatgttggcacaagcagaacatgatccacaagcttcatca
gttcttgttaccaattcaacgaaaattgcaaacaacgttagatccctgattaaaaagaaa
attaaaaaatataaaagaagagaaattattgaaaaatcattaaaagaaaatggtaaaatt
gtaataactaaaaacattagagaatctattgactttgctaacaaatatgcgcctgaacat
ctagtattaatggttaaaaatccagaaaaatatttaaaatatataaacaatgcaggttca
atatttttgggtgataatacaccagtatcagctggagattatggattaggaagtaatcat
gttttaccaactggaggatttgcaaaagcatgtggaggtctatctacagaatcatttatt
aaaaaaataactgtgcaaaaactttctaaaaaaggactactttccctaaaagatatcgta
attccactttcagaatatgaaggtttggacggacatgcaaaatctttcaagaaaagacta
gaggtgttaaaaagtgagcatgataaatgttaa

DBGET integrated database retrieval system