KEGG   Methanothermus fervidus: Mfer_0734Help
Entry
Mfer_0734         CDS       T01351                                 

Definition
(GenBank) methyl-coenzyme M reductase, alpha subunit
  KO
K00399  methyl-coenzyme M reductase alpha subunit [EC:2.8.4.1]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00680  Methane metabolism
mfv01100  Metabolic pathways
mfv01120  Microbial metabolism in diverse environments
mfv01200  Carbon metabolism
Module
mfv_M00357  Methanogenesis, acetate => methane
mfv_M00567  Methanogenesis, CO2 => methane
mfv_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mfer_0734
Enzymes [BR:mfv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     Mfer_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_alpha_N MCR_alpha MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: ADP77533
UniProt: Q49174
Position
713917..715581
Genome map
AA seq 554 aa AA seqDB search
MNKKNKKLFLEALEKKFKGESPEEKKTTFYCFGGWKQSERKREFVEYAKKLAKKRGIPFY
NPDIGVPLGQRKLMAYRISGTDAYVEGDDLHFVNNAAIQQMVDDIKRTVIVGMDTAHAVL
EKRLGVEVTPETINEYMETINHALPGGAVVQEHMVEVHPGLVDDCYAKIFTGNDELADEL
DKRVLIDINKEFPEEQAEMLKKYIGNRTYQVNRVPTIVVRCCDGGTVSRWSAMQIGMSFI
SAYKLCAGEAAIADFSFAAKHADVIEMGTILPARRARGPNEPGGIPFGVFADIIQTSRVS
DDPARISLEVIGAAATLYDQVWLGSYMSGGVGFTQYASATYTDDILDDFVYYGAEYVEDK
YGFCGVKPSMEVVKDIATEVTLYGLEQYEEYPTLLEDHFGGSQRAAVVAAAAGCSTAFAT
GNSNAGINAWYLSQILHKEGHSRLGFYGYDLQDQCGASNSLSIRSDEGLVHELRGPNYPN
YAMNVGHQPEYAGIAQAPHAARGDAFVVNPLIKVAFADNDLSFDFRWPRKEIARGALREF
MPDGERTLIIPASK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaaaataaaaaattatttttagaggcattagagaaaaaatttaaaggcgaa
tctccagaagaaaagaaaacaacattttattgttttggaggatggaaacaatctgaaaga
aaaagagaatttgttgaatatgcaaaaaaacttgcgaaaaagcgaggaattccattttat
aatccagatataggagtacctcttggacaaagaaaattgatggcatatagaatttcaggt
acagatgcatatgttgaaggagatgatttacactttgtaaataatgctgcaattcaacag
atggtagatgatataaagagaactgtaattgttggaatggatactgctcatgcagttctt
gaaaaaagacttggtgtagaagttacaccagagactatcaatgaatatatggaaacaatt
aatcatgcattaccaggtggagcagttgttcaagaacatatggtggaagtacatccagga
cttgtagacgattgttatgcaaaaatattcacagggaatgatgagttagctgatgaactt
gataaaagagtacttatagacattaataaagaatttcccgaagaacaagcagaaatgctt
aaaaaatacataggtaataggacatatcaagttaatcgagttccaacaatagttgttaga
tgttgtgatggtggaactgtttcaagatggtcagcaatgcaaataggtatgagctttatt
tcagcatataaattatgtgctggtgaagctgcaattgcagatttctcatttgctgctaaa
catgcagacgtaattgaaatgggtacaatattgccagcaagaagagctagaggtcctaat
gaacctggaggaattccatttggagtgtttgcagatataattcaaacatcaagagttagt
gacgatcctgcacgtatctctctagaggttataggtgcagcagccactttatatgaccag
gtatggttaggatcctacatgtcaggaggagtaggattcacacaatatgcaagtgctacc
tatacagatgatatcttagatgactttgtttactatggtgcagagtatgtagaagacaaa
tacggattctgtggtgtgaaaccatcaatggaagttgttaaggatatagcaaccgaagtt
acactttatggtcttgaacaatatgaagaatatccaacacttctagaggatcactttgga
ggttcacaaagagcagcagtcgttgctgcagcagcaggatgctcaacagcatttgcaact
ggaaattcaaatgctggaatcaatgcatggtacctttcacagatattacataaagaaggc
cattcaagattaggattttatggttatgatttacaagatcagtgcggagcatcaaattcc
ttatcaattagaagtgatgaaggccttgtccatgaattacgtggacctaactatccaaac
tatgcaatgaatgttggacatcaaccagaatatgcaggtatagcccaagcaccacatgct
gcaagaggggatgctttcgttgtcaatccattaataaaggttgcatttgcagacaacgat
ctcagctttgacttcagatggcccagaaaagaaattgcaagaggagcattaagagaattc
atgccagacggtgaaagaacattgataatacctgcaagtaaataa

DBGET integrated database retrieval system