KEGG   Methanothermus fervidus: Mfer_0780Help
Entry
Mfer_0780         CDS       T01351                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit B
  KO
K00578  tetrahydromethanopterin S-methyltransferase subunit B [EC:2.1.1.86]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00680  Methane metabolism
mfv01100  Metabolic pathways
mfv01120  Microbial metabolism in diverse environments
mfv01200  Carbon metabolism
Module
mfv_M00357  Methanogenesis, acetate => methane
mfv_M00567  Methanogenesis, CO2 => methane
mfv_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mfer_0780
Enzymes [BR:mfv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mfer_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrB
Motif
Other DBs
NCBI-ProteinID: ADP77579
UniProt: E3GZ47
Position
complement(751591..751908)
Genome map
AA seq 105 aa AA seqDB search
MEMLPFIHVAPEFNLALDPSAGVISTALGRDVIVLSMDDLNKELDKLEVAVDNLYNSLDP
NTIPPESYPGREGIYITQGKITNMIYGFVFGLIVFALILLKFGGV
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgcttcctttcattcatgtagcacctgaatttaatttagctttggatccatca
gctggtgtcattagtactgcacttggaagagatgtaattgttctttcaatggacgattta
aataaagagttggataaattggaggtggctgtggataatctttataattctttagatccc
aatacaattcctccagagtcatatccaggaagagaaggtatctatataactcagggaaaa
attacaaacatgatatatggatttgtatttggattgatagttttcgctttaattttactt
aaatttggaggtgtatga

DBGET integrated database retrieval system