KEGG   Mesoplasma florum W37: mflW37_0390Help
Entry
mflW37_0390       CDS       T02878                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mfw  Mesoplasma florum W37
Pathway
mfw00450  Selenocompound metabolism
mfw00970  Aminoacyl-tRNA biosynthesis
mfw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    mflW37_0390
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    mflW37_0390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mfw01007]
    mflW37_0390
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mfw03016]
    mflW37_0390
Enzymes [BR:mfw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     mflW37_0390
Amino acid related enzymes [BR:mfw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   mflW37_0390
Transfer RNA biogenesis [BR:mfw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    mflW37_0390
 Prokaryotic type
   Other AARSs
    mflW37_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AGY41106
Position
52561..54090
Genome map
AA seq 509 aa AA seqDB search
MPKKFYVTTPIYYPSGNLHIGHAYTTTLADILKRYKDMQGYESFFLTGSDEHGQKIEEKA
REARLTPIDYLEDKVESFKTLWKALKIDYTKFIRTTDSYHEETVKKIFTLLLDKGFIYKG
NYEGLYCISCEEFLNADQIDENNMCKISNTKLELVKEETYFLKTSLFQEFMENEVLASEF
LIPAYRRNEMLNSFVKPELKDLSVTRTSFSWGIPINEDPKHVVYVWLDALTNYITALGYL
QNDDLNFQKFWADENTEILQLAGKEIIRFHSIYWPIILKSLGLRQPTHLLGHGWILSKDT
KMSKSLGNVIDPIDMINKYGADALRFYIGYELPTEKDGNFTDDLFIESFNAHLANNVGNL
ISRTNQMITKYFDGFIENDNIVYDDNLTAKGIETINLYIQNMDQYKISDAIRNILDLGNA
CNKYIEETMPWNLAKEEKLDELKNVMATLQRNISIMVFLLKPILVENYADMIEQIGLNGV
ELTFDKINNWDKIIFKKLGDKKIIFKRVN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaaattttacgtaacaacaccaatctattacccaagtggtaacttacatata
ggacatgcatacacaacaactttagctgatattcttaaaagatataaagacatgcaaggc
tatgaatcattcttcttaactggtagtgatgagcacggtcaaaaaatagaagaaaaagca
agagaagcccgcttaacaccaattgattatcttgaagataaagttgaaagttttaaaaca
ctttgaaaagctttaaaaattgattacacaaaatttataagaactacagattcatatcat
gaagaaactgttaaaaaaatatttactttattattagataaaggttttatttacaaaggc
aattatgaaggattatattgtattagttgtgaagagtttttaaatgctgatcaaatagac
gaaaacaatatgtgtaaaatatctaatacaaaattagaattagttaaagaagaaacttac
tttttaaaaacttctttatttcaagagttcatggaaaatgaagttttagcaagtgaattt
ttaattccagcatatagaagaaatgaaatgttaaattcttttgttaaaccagagcttaaa
gacttatcagtaacaagaacttctttttcatgaggtatacctattaatgaagatccaaag
catgttgtttatgtttgattagatgctttaacaaactatataacagctcttggttattta
caaaatgatgatttaaattttcaaaaattttgagctgatgaaaatacagaaattttacaa
ttagcaggtaaagaaattattcgtttccattcaatatattgacctataattttaaaatca
ctaggtttacgccaaccaacacacttattgggtcatggttgaattttaagtaaagacaca
aagatgagtaagtctctaggaaacgttattgatccaatagacatgattaacaaatatgga
gcagatgctttaagattttatattggttatgagttaccaacagaaaaagatggtaatttt
actgatgatttatttattgaatcttttaatgcacacttagctaataatgttggtaactta
atatcaagaacaaatcaaatgataactaaatattttgatggttttattgaaaacgacaat
attgtgtatgatgataacttaacagcgaaaggtattgaaacaattaatttatatatacaa
aatatggatcaatacaaaatcagtgatgcaataagaaatatattagacttaggtaatgca
tgtaataaatacatcgaagaaacaatgccttgaaatttagctaaagaagaaaaactagat
gaactaaaaaatgtaatggcaacattgcaacgtaatatatctattatggttttcttgtta
aaaccaatacttgtagaaaactatgcagatatgattgagcaaattggtttaaatggtgtt
gagttaacgtttgataaaataaacaattgagataaaataatatttaaaaaattaggagat
aaaaaaattatcttcaaaagagttaattaa

DBGET integrated database retrieval system