KEGG   Mesoplasma florum W37: mflW37_7200Help
Entry
mflW37_7200       CDS       T02878                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
mfw  Mesoplasma florum W37
Pathway
mfw00520  Amino sugar and nucleotide sugar metabolism
mfw01100  Metabolic pathways
mfw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    mflW37_7200
Enzymes [BR:mfw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     mflW37_7200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Polbeta
Motif
Other DBs
NCBI-ProteinID: AGY41787
Position
complement(812395..813543)
Genome map
AA seq 382 aa AA seqDB search
MILKNARIVLENKIIENGQILIENGRIAEISENEIVNNNEEILDLKGNTILPGFIDCHVH
GGYGVDFETGNAKRFEIFSKNVVKEGITSYIQASVTNSLENNLKYLKEFSDFSLSKNNGA
KCLGIHMEGPFISAEKKGAHDPNLLVNPDIELMQKFIQTSGGNVKIVTYATELQNGEFTK
YLINNNIIPSVGHTNQEAWEIEKDYNLGLRHVTHLFNGMSGVDHYRPGLAVSALNHKDML
VEVISDGIHLKKEILDLIYKTKGPENICIITDSINAKGLEDGQYKIGDLEVVKKGIEVKL
KSNGVLAGSGATYNHNVKFYKESSDIELTDLIKMTSINIAKQLKIYSETGSIEVNKKADL
VVLDKDFNVLYTFVEGNKVYAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatacttaaaaatgcaagaattgtcttagaaaacaaaataattgaaaacgggcaaatt
cttattgaaaacggacgaatagcagaaatatctgaaaatgaaattgtaaataataatgaa
gaaatattggatttaaaaggcaacacaattcttcctggtttcatagattgtcatgttcat
ggaggttatggtgttgattttgaaaccggcaatgcaaaaagatttgaaatattttctaaa
aacgtagtgaaagaaggtataacatcttacattcaagcaagtgttacaaatagtttagaa
aataatcttaagtatttaaaagaattctctgatttttctttatcaaaaaataacggtgca
aaatgcttaggaatacacatggaagggccatttatttctgcagaaaaaaaaggtgcacat
gaccctaatttacttgttaatccagacattgaattaatgcaaaaatttattcaaacttct
ggtggtaatgtaaaaatagttacttatgcaacagaactacaaaatggtgaatttacgaag
tatttaattaataataatataattccttctgttggtcatacaaatcaagaagcgtgagaa
atagaaaaagattataatttaggtttaagacatgtaactcatttatttaatggaatgagt
ggagtagatcattatagacccggattagctgtttcggccttaaatcataaagatatgctg
gttgaagttatatctgatggaattcatttgaaaaaagaaatattagatctaatttataaa
acaaaaggtccagaaaatatttgcataattactgactcaattaacgcaaaaggattagaa
gatggccaatataaaattggagatttagaagttgttaaaaaaggtattgaagtaaagtta
aaaagcaatggagttttagctggatcaggagctacatataatcataatgttaaattttat
aaagaatcatctgacattgaattaacagatttaattaaaatgacatctattaatatagct
aaacaattaaaaatatattctgaaacaggaagtatagaagttaataaaaaagcagatctt
gttgttttagataaagattttaatgtactatacacatttgttgaagggaataaagtatat
gcaaaataa

DBGET integrated database retrieval system