KEGG   Mycolicibacterium fallax: MFAL_01620
Entry
MFAL_01620        CDS       T06894                                 

Definition
(GenBank) oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mfx  Mycolicibacterium fallax
Pathway
mfx00903  Limonene and pinene degradation
mfx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MFAL_01620
Enzymes [BR:mfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MFAL_01620
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: BBY96695
Position
complement(167655..168500)
AA seq 281 aa
MAGRVDGKVALVTGAARGQGRSHAVRLAEEGADIIAIDICAPIRPGTETAIPASTSDDLA
QTAELVKGLGRRVVTAEVDVRDFDGVKAAVDSGVEQLGGLDIIVANAGIGNGGDVLHETS
QLDWDEMIDINLSGVWKSVKAGVPHLIAGGKGGSIVLTSSVGGLKAYPHCGNYVAAKHGV
VGLMRGFAVELGQHSIRVNTVHPTHVATPMLHNEGTFKMFRPDLENPGPDDMAPICQLFH
TLPIPWVEAVDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 846 nt   +upstreamnt  +downstreamnt
atggcaggaagagtcgacggcaaggtcgcgctggtcaccggcgcggcgcgcggccagggc
cgcagccacgcggtgcggctggccgaggagggcgccgacatcatcgcgatcgacatctgc
gcgccgatccgccccggcaccgagaccgccatcccggcatcgacgtccgacgatctggcc
caaaccgccgagctggtcaagggactgggtcgccgggtggtgaccgccgaggtcgacgtc
cgtgacttcgacggcgtcaaggccgccgtggacagcggcgtcgagcagctcggcgggctg
gacatcatcgtcgccaacgccggcatcggcaacggcggcgacgtgctgcacgagaccagc
cagctggactgggacgagatgatcgacatcaacctgtccggggtgtggaagtcggtcaag
gccggcgtgccgcatctgatcgccggcggcaagggcggctcgatcgtgctgaccagctcg
gtcggcggcctgaaggcctacccgcactgcggcaactacgtcgcggccaagcacggcgtg
gtcggcctgatgcgcggcttcgccgtcgagctcgggcagcacagcatccgggtgaacacc
gtgcacccgacgcacgtcgccaccccgatgctgcacaacgagggcaccttcaagatgttc
cgcccggacctggagaaccctggccccgacgacatggcgccgatctgccagctgttccac
accctgccgatcccgtgggtggaagccgtcgacatcagcaacgcggtgctgttcctggcc
tccgacgaggcccgctacatcaccggggtgaccctgcccgtggacgcgggcagctgcctg
aagtag

DBGET integrated database retrieval system