KEGG   Methanosarcina flavescens: AOB57_000550Help
Entry
AOB57_000550      CDS       T05666                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
mfz  Methanosarcina flavescens
Pathway
mfz00270  Cysteine and methionine metabolism
mfz00920  Sulfur metabolism
mfz01100  Metabolic pathways
mfz01110  Biosynthesis of secondary metabolites
mfz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AOB57_000550
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AOB57_000550
Enzymes [BR:mfz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AOB57_000550
    2.3.1.46  homoserine O-succinyltransferase
     AOB57_000550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 CBS Esterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AYK13899
Position
complement(142580..144139)
Genome map
AA seq 519 aa AA seqDB search
MEFSAQNSSFKSHFSGKKGQNLGIVRSMNYETPGIFRLESGKTLSRIRIEYEMYGKMNAD
KSNVILICHALTGDAHAAGFHAGDKKPGWWNIVIGPNKAFDTEKYCIICSNVIGGCKGST
GPSSINPETGKPYGVSFPIITIADMVNAQKKLIEHLGVKQLFAVAGGSMGGMQVLQWTVS
YPEMVKKAIAIATTASTTPQQIAFGAIGRKAITDDPKWNGGNYYGKEIPAQGLALARMIG
HITYLSDASMQKKFGRAQLAETGQDLSKISSETSSETFPDSFSNFQVESYLNYQGDTFTK
RFDANSYLYITKAVDFFDLSNNGSLIEGFSGVKAKYLVIAITSDWLYPPYQSQEIVSALT
ANGVDARYEEIRSQYGHDAFLLEEGQLNYLIRSFLSQVLVSDIMSPNFYSISRDETLENA
SMLMVKKKVNHLPVVSEDGKLEGIVTSWDITKAVACKITELDEIITRDVKCVYAGEKIEV
ASSIMEDYSISALPVIDSENRVIGMVTSESISALIGRFS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggagttctcagctcagaattcttcttttaaaagccatttttcgggaaaaaaaggtcag
aacctgggaatagtccgctcaatgaactatgaaactccagggattttcaggcttgagagt
ggaaaaaccctctcccgcatcaggatagagtatgagatgtacgggaagatgaatgcggat
aagagcaacgttatcctgatatgtcatgctcttaccggggatgcccatgctgccggattt
catgcaggcgacaaaaagcctggctggtggaatattgtaatcggcccgaataaagctttt
gatactgaaaaatattgtatcatctgttcaaatgtaatcgggggatgcaaaggttctaca
ggcccttcttccattaaccctgagactgggaaaccctacggcgtctcatttcccataatc
actatagcagacatggtaaatgcccagaagaaacttatcgagcatcttggagtaaaacag
ctttttgcagttgcaggcggctcaatgggcggtatgcaggtgcttcaatggactgtcagc
tatcctgaaatggtaaagaaggcaatagcaatcgcaacaaccgcatccacgactccacag
cagattgcgtttggggcaataggtcggaaagccataactgatgacccaaaatggaatggg
gggaattactacggaaaggaaattcctgcacagggtcttgcacttgcccgtatgataggc
cacatcacatacttaagcgatgcttcaatgcaaaagaagttcggaagggctcaattggct
gaaacaggtcaggatttatcaaaaatttcttccgaaacttcttctgaaactttccctgat
agcttttcgaatttccaggtcgagagctacctgaattatcagggcgatacctttactaag
cgttttgatgccaattcctatctttatattacaaaagccgtggacttctttgacctctca
aataacgggtcccttatagagggtttttccggagtcaaagcgaaatatctcgtaattgcc
ataacctcagactggctttatcccccttaccagtctcaggaaattgtttctgctcttact
gcaaacggggttgatgccagatacgaggagatcaggtcccagtacgggcatgatgctttt
ctgcttgaggaggggcagctcaactaccttataaggagctttctctcacaggttcttgta
agtgatattatgagcccgaatttctattccatttccagagatgagactctggaaaatgcc
tcaatgctcatggtaaaaaagaaagtaaaccatctgcctgtcgtatccgaggacggaaag
cttgaaggcatagtaacctcctgggatatcacaaaagctgtcgcctgtaagatcacggaa
ctggatgaaataatcactcgcgatgtaaaatgtgtgtacgcgggcgaaaaaatcgaggtc
gcctcttcaataatggaagattactcgatttccgcgcttccggtcattgattcagaaaac
cgggtcataggcatggttacaagtgaaagcataagcgcccttatcggaaggttcagttaa

DBGET integrated database retrieval system