KEGG   Methanosarcina flavescens: AOB57_005405Help
Entry
AOB57_005405      CDS       T05666                                 

Definition
(GenBank) alpha-keto acid decarboxylase family protein
  KO
K04103  indolepyruvate decarboxylase [EC:4.1.1.74]
Organism
mfz  Methanosarcina flavescens
Pathway
mfz00380  Tryptophan metabolism
mfz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AOB57_005405
Enzymes [BR:mfz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.74  indolepyruvate decarboxylase
     AOB57_005405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AYK14698
Position
1200475..1202103
Genome map
AA seq 542 aa AA seqDB search
MPTVIQYLLGRLKQLGIRDIFGVPGDFAFPINNAICDDNELRWIGCCNELNAAYAADGYA
RINRISALSTTFGVGELSALCGIAGSYAENNMVFHIVGIPKMQTQKRHAIVHHSLGDGEY
GTFMDMATPVVCASTMLTPENCVDEVERVIEAALENRQPVYIAIPHDYVNAEISSLTAPK
NVFVKSDPATLEEVVSIITAKLSNAKQACIMPGFLVDRFGLKDLAMAVINASGLPYATMA
LDKAVLDETNPSYMGLYMGQLINPEIQEFVESCDCILAIGVVMSDINMGMFTAKLDKSRV
INIMPFSVHIGNTDYINVKMLDVLEELSRRLNKRTDVRGPVAKHPAVPEVNAEDPITADY
LYAKYAEFFKLDDIVVVDSTSSFYGLLPLPLPEGVKFLSQMLWGAIGWATPAAFGTALAA
PDRRVILITGEGSHQMTVQEISQFYRYGLKPIIFVLNNHGYLIERMLSKKLDYCYNDIPE
WQYHKLPEVLGCNNWITRKTTTCGDLDKIMRELDTAKVGAYIEIVTPELSAPPLMKAIHE
NL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagttattcaatatcttctgggtagattaaagcaactgggaataagggatatt
ttcggtgtgccaggagactttgcgtttcctatcaacaatgcgatatgcgatgataatgaa
cttcgctggataggttgctgcaacgagctgaatgctgcatatgctgctgacggctatgct
cgtattaatcgtatatcagcactgtctactacctttggagtaggtgagctctcggcatta
tgcggtatagcaggctcttatgcggagaacaatatggtatttcatattgtaggaattccg
aaaatgcagacacagaagaggcatgccatagtgcatcattcgctgggtgacggagagtac
ggcacatttatggatatggctacgccagtagtatgcgccagtacaatgcttactccggaa
aactgcgttgatgaagtcgagcgcgttatcgaggcggccctggaaaatcgccagcctgtc
tacattgcaatacctcacgactatgtgaatgcagagatttcatcccttacggcaccaaag
aatgtgtttgtaaaaagcgatcctgcgactcttgaagaagtggtctcgattattacagct
aagttatcaaacgcaaaacaagcctgtattatgccgggcttccttgttgacagatttggt
ctcaaagacctcgctatggctgttattaatgcttcaggcctaccttatgctactatggcg
ctggacaaggccgtacttgatgagacaaatccctcctacatgggattatatatgggacag
cttatcaatcctgaaattcaggaatttgtggaatcctgcgactgcatacttgccataggc
gttgtcatgtctgatattaatatgggcatgttcacggcgaagctggataaatcccgagtt
atcaatatcatgcctttcagtgtccatataggaaatactgattatatcaatgtaaaaatg
cttgatgtactggaggagctttccagaaggcttaataagcgtactgatgtcaggggacct
gttgcaaaacatcccgcagttccagaggtaaatgctgaagacccaataacagctgactat
ttatacgccaagtacgccgaattttttaagctcgatgacatagttgtagttgactcaacc
tcatccttttatgggttactgcctttacctttaccagaaggagttaagttcctgagccag
atgctctggggagcgataggctgggctactcccgctgcctttggcactgcactggctgca
ccagacagacgagtaattcttataacgggcgaagggtcacaccagatgacagtccaggag
atcagccagttttaccgctatggtctaaagcctattattttcgtgctgaataatcacggc
tacctgatagaaagaatgctatctaaaaaattagattactgttacaatgacattccagag
tggcaataccataagttgccagaggtgcttggttgtaataactggataacaagaaaaacc
accacctgtggtgaccttgataagatcatgagagagctggatactgctaaggtcggcgca
tatatagaaatagttacgccagaactctcggctcccccacttatgaaagcaatccacgaa
aatttataa

DBGET integrated database retrieval system