KEGG   Mycoplasma gallisepticum CA06_2006.052-5-2P: HFMG06CAA_5291Help
Entry
HFMG06CAA_5291    CDS       T02326                                 

Gene name
cysS
Definition
(GenBank) Cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
mgac  Mycoplasma gallisepticum CA06_2006.052-5-2P
Pathway
mgac00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mgac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HFMG06CAA_5291 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgac01007]
    HFMG06CAA_5291 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mgac03016]
    HFMG06CAA_5291 (cysS)
Enzymes [BR:mgac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     HFMG06CAA_5291 (cysS)
Amino acid related enzymes [BR:mgac01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   HFMG06CAA_5291 (cysS)
Transfer RNA biogenesis [BR:mgac03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HFMG06CAA_5291 (cysS)
 Prokaryotic Type
    HFMG06CAA_5291 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f DALR_2 RapH_N
Motif
Other DBs
NCBI-ProteinID: AFP80781
Position
complement(903996..905303)
Genome map
AA seq 435 aa AA seqDB search
MKLYDTLTKTNVDINANEINIYVCGPTVYDHIHIGNLRPIVTFDVLRRLLEHSNKKVNFV
HNITDIDDKIINQAQRLNLSEEEVTKRYTSAYFEILDELNIKLPKIVKVTDVMNGIIKYI
EKIYDKQYAYELDGDIYFDTTKIADYGVLSKRKLDEQISGIRVKSNENKTSPNDFVLWKK
TIEGIKWNSRFGLGRPGWHTECAYIIDQEFKQKGFVIHGGGIDLVFPHHENENAQNLALH
NKNLVNCWVHVGYLLIDNEKMSKSLNNFIYVKHLIESHNYRAIRWVFYNTAHTQPLNFDG
TIIKAAQKDVEKIISTVNRFRTFLIANKNNIPSSSLVCEEFKKALFDNLNFANATKVIWD
LIKVLNESIAYKKIDENIWAYQQLIWCLEIYGIVPDMIHNEQIIDQINQWTKLLNNKDYE
KADTIRNKLINKKVL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactgtatgataccctaacaaaaacaaacgtagatattaatgctaatgagatcaat
atttacgtttgtggaccaactgtttatgatcatattcatattggtaatttaagaccaata
gttacctttgatgtattaagaagattattagaacattcaaacaagaaagttaattttgtt
cataatattacagatatagatgacaaaattattaatcaagctcagcgcttgaatttatct
gaagaagaagtaaccaaaagatatacatctgcttactttgagattttagatgagcttaat
attaagttacccaagatcgttaaggtaacagacgtaatgaatgggatcattaagtatatt
gaaaaaatttatgataagcaatatgcttatgaactggacggagatatttattttgatacc
acaaagattgctgattacggggttttatctaaacgtaagttagatgagcagatcagcggg
attagagttaaaagtaatgaaaataaaacaagtcctaatgactttgttttatgaaaaaaa
acaattgagggcattaagtgaaattctagatttggtctagggcgtccaggctgacacaca
gaatgtgcttacattatcgaccaagagtttaagcaaaaagggtttgttattcatgggggt
gggattgatttagtattccctcaccatgaaaatgagaacgcacaaaatttagcgttacat
aataagaatttagtaaattgttgagtgcatgtcggatatcttttaattgataatgaaaag
atgtcaaaatcgcttaacaactttatctatgttaagcatttaattgagtcgcacaattat
cgagctattcgatgagtgttttataatactgctcacactcaaccattaaactttgatgga
acgataattaaagctgcccaaaaagatgttgaaaaaatcattagtacagtaaaccggttt
agaacttttttaattgctaataagaacaatattccaagcagttcactagtttgtgaagag
tttaaaaaagcgctgtttgataacttaaattttgccaatgcaactaaagttatctgagac
ttaatcaaagtcttaaacgaatcaattgcttacaaaaagattgatgaaaatatctgggct
taccaacaattaatctggtgtttagaaatctatggaatcgttccagatatgattcataat
gaacagatcattgatcagattaatcaatgaactaaattattaaacaacaaggactatgaa
aaagccgatacaataagaaataaattgattaataaaaaagttttataa

DBGET integrated database retrieval system