KEGG   Mycoplasma genitalium G37: MG_026Help
Entry
MG_026            CDS       T00002                                 

Gene name
efp
Definition
(GenBank) translation elongation factor P
  KO
K02356  elongation factor P
Organism
mge  Mycoplasma genitalium G37
Brite
KEGG Orthology (KO) [BR:mge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mge03012]
    MG_026 (efp)
Translation factors [BR:mge03012]
 Prokaryotic Type
  Elongation factors
   MG_026 (efp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EFP Elong-fact-P_C EFP_N
Motif
Other DBs
NCBI-ProteinID: AAC71242
UniProt: P47272
Position
29552..30124
Genome map
AA seq 190 aa AA seqDB search
MAEMIEAKNLRNGQTIFGPNKEILLVLENTFNKTAMRQGIVKTKVKNLRTGAIVWLEFTG
DKLEQVIIDKKKMNFLYKDGNNFVFMDQKDYSQIEINEKKLEWEKNFITEEIEVTVITYQ
DEILGVNLPDLVPIEVEFAEDAIQGNTANMARKKARLVTGYELDVPQFINTGDKIVIATV
DGNYRERFNK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatgatagaagcaaaaaatcttcgtaatgggcaaaccatcttcggtcctaac
aaagagattttattagtactggaaaatacatttaacaaaaccgcaatgcgccagggaatt
gttaaaactaaagttaaaaacttaagaactggggctattgtttggcttgaatttactggt
gacaaattagaacaagtaattattgataagaaaaaaatgaatttcttatacaaagatggt
aataactttgtttttatggatcaaaaagactacagtcagattgagattaatgaaaaaaaa
ttagagtgggaaaaaaatttcattactgaagaaattgaagttactgttattacttatcaa
gatgaaattctaggagttaatttacctgatttagttcctattgaagttgagtttgctgaa
gatgctattcagggcaatactgctaacatggcaagaaaaaaagcacgccttgtaactggt
tatgaacttgatgtaccccaatttattaatactggtgataagattgtaattgccactgtt
gatggcaattaccgtgaaaggtttaacaaataa

DBGET integrated database retrieval system