KEGG   Mycoplasma genitalium G37: MG_045Help
Entry
MG_045            CDS       T00002                                 

Definition
(GenBank) spermidine/putrescine ABC transporter, spermidine/putrescine binding protein, putative
  KO
K11069  spermidine/putrescine transport system substrate-binding protein
Organism
mge  Mycoplasma genitalium G37
Pathway
mge02010  ABC transporters
Module
mge_M00299  Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:mge00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MG_045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mge02000]
    MG_045
Transporters [BR:mge02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299] [OT]
    MG_045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_8 DsrC
Motif
Other DBs
NCBI-ProteinID: AAC71261
UniProt: P47291
Position
53204..54655
Genome map
AA seq 483 aa AA seqDB search
MKKQLKYCFFSLFVSLSSILSSCGSTTFVLANFESYISPLLLERVQEKHPLTFLTYPSNE
KLINGFANNTYSVAVASTYAVSELIERDLLSPIDWSQFNLKKSSSSSDKVNNASDAKDLF
IDSIKEISQQTKDSKNNELLHWAVPYFLQNLVFVYRGEKISELEQENVSWTDVIKAIVKH
KDRFNDNRLVFIDDARTIFSLANIVNTNNNSADVNPKEDGIGYFTNVYESFQRLGLTKSN
LDSIFVNSDSNIVINELASGRRQGGIVYNGDAVYAALGGDLRDELSEEQIPDGNNFHIVQ
PKISPVALDLLVINKQQSNFQKEAHEIIFDLALDGADQTKEQLIKTDEELGTDDEDFYLK
GAMQNFSYVNYVSPLKVISDPSTGIVSSKKNNAEMKSKQMSTDQMTSEKEFDYYTETLKA
LLEKEDSAELNENEKKLVETIKKAYTIEKDSSIRWNQLVEKPISPLQRSNLSLSWLDFKL
HWW
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagttaaaatattgctttttctcactttttgttagtctctcatcaatattg
agtagttgtggttcaacaacatttgtactagctaactttgaatcttatatttcgccctta
ttgctagaaagagtacaagaaaaacatcccttaactttcttgacttatcctagtaatgaa
aaactaattaatggttttgctaacaacacttattcagtagcagtagcatctacttatgca
gttagtgaattgatagaaagggatctattatcaccaatagattgaagtcagtttaatctg
aaaaaaagtagtagttcaagtgataaagtaaataatgccagtgatgcaaaggatttgttt
attgattcaattaaagagatcagtcaacaaaccaaagatagtaaaaacaatgaattactg
cattgagcagttccttattttcttcaaaacttagtgtttgtttatcgtggtgaaaaaatt
agtgaacttgaacaggaaaatgtttcatgaactgatgtaattaaagcaattgtgaaacac
aaagatcgctttaatgacaataggttagttttcattgatgatgctagaacgatcttttca
cttgctaacatcgttaatactaacaacaattcagctgatgttaatccaaaggaagatgga
attggttatttcactaatgtctatgaaagctttcaaagacttggattaacaaaatctaat
ttagatagtatctttgttaattctgattccaatattgtgatcaatgaattggcaagtggt
agaagacaaggaggaattgtttacaatggtgatgcagtgtatgctgcattgggcggtgat
ttacgtgatgaattgagtgaagaacagattcctgatgggaacaactttcacattgtgcaa
cccaaaatttccccagttgctttagatcttttggttatcaataaacaacaatctaatttt
caaaaagaagcacatgagatcatttttgatcttgctttggatggtgctgatcaaactaaa
gaacagttaattaaaactgatgaagaattgggtactgatgatgaagacttttacttaaaa
ggagcgatgcaaaactttagttatgtgaactatgtttcaccattaaaagtaatatctgat
ccaagtactggaatagtcagttccaaaaagaataatgctgaaatgaaaagtaaacaaatg
tcaactgatcaaatgactagtgaaaaagaatttgattattacactgaaacacttaaagca
ttattagagaaagaagatagtgcagaattaaatgaaaatgaaaaaaaactagttgaaacc
attaagaaagcttacactattgaaaaagatagttcaattcggtgaaaccaattggtcgaa
aaaccaatttctcccttacaacgtagtaatttatcgttatcttgattagactttaaatta
cactggtgataa

DBGET integrated database retrieval system