KEGG   Mycoplasma genitalium G37: MG_048Help
Entry
MG_048            CDS       T00002                                 

Gene name
ffh
Definition
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge02024  Quorum sensing
mge03060  Protein export
mge03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    MG_048 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MG_048 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MG_048 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mge02044]
    MG_048 (ffh)
Enzymes [BR:mge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     MG_048 (ffh)
Secretion system [BR:mge02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   MG_048 (ffh)
  Eukaryotic Sec-SRP protein
   MG_048 (ffh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA AAA_17 G-alpha AAA_33 cobW AAA_22 Zeta_toxin AAA_31 ATP_bind_1 Roc AAA_28 ResIII AAA_24 6PF2K Arf ParA APS_kinase PduV-EutP DUF373 GTP_EFTU Thymidylate_kin MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AAC71264
UniProt: P47294
Position
complement(56969..58309)
Genome map
AA seq 446 aa AA seqDB search
MFKAMLSSIVMRTMQKKINAQTITEKDVELVLKEIRIALLDADVNLLVVKNFIKAIRDKT
VGQTIEPGQDLQKSLLKTIKTELINILSQPNQELNEKRPLKIMMVGLQGSGKTTTCGKLA
YWLEKKYKQKTMLVGLDIYRPAAIEQLETLSQQTNSVFFAQGTQPVAKTTKAALSAFKTA
KCQTIICDTAGRLQTNETLMDELVSVKNELNPDEIIMVVDGLSGQEIINVAQTFHKRLKL
TGFIISKLDSDARAGAALSLASLLQVPIKLIGVSEKLDGLEQFHPERIANRILGLGDVMS
LVEKAEQVFDKKDLTKTISKMFLGKMDLEDLLIYMQQMHKMGSVSSLIKMLPANFSVSEE
NAELIENKIELWKVLINSMTREERRHPKLINRDPNRKQRIIKGSGRKMDELNKLMKEWNK
MQLKATEMGKLLKTGSNPFGGFGQFF
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagcaatgttatcaagcatcgttatgcgcacgatgcaaaaaaaaattaacgct
caaacgatcactgagaaagatgtagagttagttctaaaagagattagaattgcattgctt
gatgctgatgttaacctgcttgttgttaaaaatttcatcaaagcaattagagataaaaca
gtaggacaaaccattgaacctggtcaagatttgcaaaagtctctattaaaaacaatcaaa
acagaactaattaatatcttaagccaacccaaccaagaactaaatgaaaaaagaccttta
aaaataatgatggttggtttacaaggatcaggtaaaacaacaacttgtggcaaactagct
tattgacttgaaaagaaatacaagcaaaaaacaatgttagtaggcttggacatctacaga
cccgctgccattgaacaacttgaaacgctttcacaacaaactaacagcgtattttttgca
caaggcactcaaccagttgctaaaacaacaaaagcagcactcagtgcttttaaaactgca
aaatgtcaaacaatcatttgtgataccgctggtagattacaaacaaatgaaacattaatg
gatgaattggtaagtgttaaaaatgaattaaatcctgatgaaattatcatggtagtagat
ggattaagcggtcaggaaattatcaatgttgctcaaacgttccacaaacgtttaaaacta
actggatttattatcagtaaattagacagtgatgctagagcaggagctgcactttcatta
gcttcacttttacaagtacccattaaattaattggtgtttctgaaaaattagatggattg
gaacaatttcatcctgaaaggatagccaatcggatcttaggtttgggtgatgtaatgagt
ttagttgaaaaagctgaacaagtttttgataaaaaagatttaactaaaaccatcagcaag
atgtttttgggaaaaatggatttagaagatcttttgatctacatgcaacaaatgcacaaa
atgggaagtgtcagttcactgataaaaatgttgcctgctaacttttctgtatcagaagaa
aatgctgaattaattgaaaacaaaattgaactatgaaaggttttaattaactctatgact
agagaagaaaggagacatcccaaattaattaatcgtgatcctaatagaaaacagcgcatc
ataaaaggatcagggagaaaaatggatgagttaaacaaactgatgaaggaatgaaataag
atgcaactaaaagcaacagaaatgggtaaactattaaaaacaggtagtaacccgtttggt
ggatttggacaattcttttaa

DBGET integrated database retrieval system