KEGG   Mycoplasma genitalium G37: MG_051Help
Entry
MG_051            CDS       T00002                                 

Gene name
pdp
Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00240  Pyrimidine metabolism
mge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MG_051 (pdp)
Enzymes [BR:mge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MG_051 (pdp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C DUF1664 DegS
Motif
Other DBs
NCBI-ProteinID: AAC71267
UniProt: P47297
Position
59740..61005
Genome map
AA seq 421 aa AA seqDB search
MNIINLINKKQRGKALNLAEINWFVNAVLNKTIADYQITAFLMAIWFKGMNPNELFLLTK
AMVDTGEIIKFNHHGKISVDKHSTGGIGDKVSLALVPILTSLGFSVAKLSGRGLGYTGGT
IDKLEAVGVKTELTDQQAQACLDKNDCFIIGQSKDIAPVDKVLYGLRDITGTVDSLPLIA
SSIMSKKLAVMNEYIFIDLKYGKGAFCKTKKIANELAKLMQSIAKSFKRKLSVKLSDMNQ
VLGKAVGNVIEVNEAVNFLKQDLDQVGQDFIDLMQTIVINILLETKQAKTKQKAIELYQD
VLTSKKAWNRFLSFIESQGGNVELFTQKEGFFKPKYKASIKAEKSGILHFTDPIDLAKIG
INLGAGRMKKTDQIDPMAGLFLMKKDNESVAVGDTVLNLYSSSPISNEYISAAQKTIIIN
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcattaatttaattaataaaaaacaacgcggaaaagctttaaatttagctgaa
atcaattggtttgttaatgctgttttaaacaaaaccattgctgattatcaaattactgca
tttttgatggctatttggtttaaagggatgaacccaaatgaactttttttattaacaaaa
gcaatggtggatactggtgaaattattaagtttaatcaccatggcaagattagtgttgat
aaacattcaactggtggtattggtgataaggtttctttagcattggttcctatcttaact
agtttaggatttagtgttgctaaattatcaggaagaggccttggttatactggtggaaca
attgataaattagaagcagttggagttaaaacagaattaactgaccaacaagcacaagca
tgtttagataaaaatgattgttttatcatcggacaaagtaaggacatcgcaccagttgat
aaagtactttatggtttaagagatattactggaacagttgatagtttgcctttaattgca
tctagtattatgtctaaaaagctagcagttatgaacgagtatattttcattgatcttaaa
tatggaaaaggtgccttttgtaaaactaagaaaattgctaacgaacttgcaaaactgatg
caaagtattgctaaaagttttaaaagaaagctgtctgttaaattaagtgatatgaatcaa
gtacttggtaaagctgttggcaatgtaattgaagttaatgaagctgttaactttctaaaa
caagatttagatcaagtaggacaagattttattgatttaatgcaaacaattgttattaac
attctacttgaaacaaaacaagcaaaaaccaaacaaaaggctattgaactttatcaggat
gttttaactagtaaaaaagcatgaaatcgctttttatcttttattgaatctcaaggagga
aatgttgaattatttactcaaaaagaaggtttttttaaacctaagtataaggcatctata
aaagctgaaaaaagtggtatactacattttactgatccaattgatttagctaaaattggg
attaatctaggggcaggtaggatgaagaaaacagatcaaattgatccaatggcagggtta
tttttaatgaaaaaagataatgagtctgtggcagttggagacactgtattaaacctgtat
agttctagtcctattagcaatgaatatatctctgctgctcaaaaaacaataattattaat
aaataa

DBGET integrated database retrieval system