KEGG   Mycoplasma genitalium G37: MG_059Help
Entry
MG_059            CDS       T00002                                 

Gene name
smpB
Definition
(GenBank) SsrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
mge  Mycoplasma genitalium G37
Brite
KEGG Orthology (KO) [BR:mge00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    MG_059 (smpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpB AAA_31 PH_9
Motif
Other DBs
NCBI-ProteinID: AAC71276
UniProt: P47305
Position
complement(67206..67643)
Genome map
AA seq 145 aa AA seqDB search
MLILVNNPKAKYDYHLMESYCAGIVLKGSEVKALSLGQGSLKEAYVFVKNNELFLEQFTI
PPYSFAGPLNHASDRIKKLLLNKHEIKQIINKKQQQSLSVIPSKVFFRNGKIKVEIWLAK
PKKKFDKRETIKKKTIRRELEAEYR
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgttaattcttgttaacaatcctaaggctaaatatgactatcatttaatggaatcttat
tgtgctggaatagttttaaaaggaagtgaagttaaagctttaagtttaggtcaaggtagt
ttaaaagaagcttatgtttttgttaaaaacaatgagctttttttagaacagttcactatt
ccaccttatagttttgcaggtccattaaatcacgcttcagatagaattaagaaactttta
ttaaataaacatgaaattaaacaaattatcaataaaaaacaacaacaatctttatctgta
atcccaagtaaagtattctttagaaatggcaaaattaaagtggaaatttgattggcaaaa
cctaaaaagaaatttgacaaacgtgaaactattaaaaagaaaacaatccgacgcgagctt
gaagctgagtatcgataa

DBGET integrated database retrieval system