KEGG   Mycoplasma genitalium G37: MG_076Help
Entry
MG_076            CDS       T00002                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ERGIC_N
Motif
Other DBs
NCBI-ProteinID: AAC71294
UniProt: P47322
Position
complement(102454..102870)
Genome map
AA seq 138 aa AA seqDB search
MVLNQNKNSNKAEYGGIVVSVFYLILFFLILNITIYFHKSTNFTVVVKNSVLTSFFVNLL
LVCLQGIFRLKTCDGMRYEISKFNRYLKLGSVYAKPLVSFNQYQDQSATYRQKTSGFWWM
NLIVYLVGSLVSGLVSLL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggttttaaatcaaaacaaaaacagtaataaagctgagtatggtgggatagttgttagc
gtattttatctaatccttttctttttgatcttaaacattactatttattttcacaagtca
accaattttacagtggttgttaaaaattcagtactaactagcttttttgttaacttatta
cttgtttgtttacaggggatattccgtttaaaaacttgtgatggaatgcggtatgaaatt
agtaagtttaacagatatcttaagttaggtagtgtttatgcaaaaccattagttagtttt
aatcaatatcaagatcaaagtgcaacttacagacaaaaaactagtgggttttggtggatg
aacttgattgtttatctagttggtagtttagttagtggtttagtttcattactctag

DBGET integrated database retrieval system