KEGG   Mycoplasma genitalium G37: MG_082Help
Entry
MG_082            CDS       T00002                                 

Gene name
rplA
Definition
(GenBank) ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
mge  Mycoplasma genitalium G37
Pathway
mge03010  Ribosome
Module
mge_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mge00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MG_082 (rplA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mge03011]
    MG_082 (rplA)
Ribosome [BR:mge03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MG_082 (rplA)
  Bacteria
    MG_082 (rplA)
  Archaea
    MG_082 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1
Motif
Other DBs
NCBI-ProteinID: AAC71300
UniProt: P47328
Position
109675..110355
Genome map
AA seq 226 aa AA seqDB search
MKKLSKRMQAVTKLIDKNKLYPIQEAFELIKKTAITKFVSSVDIAVSLNLDTTKAEQQLR
GAIAFPFSIGKSIRILAITDDEKKASEAGADFVGGLDKIEAIKNGWLDFDLIITSPKFMG
ALGKLGKLLGTRGLMPNPKTETVTDDVVSAIKAYKKGKKEYRTDSFGNIHLSLGKTDTKT
EHLVANAMALIDLIKSKRPSTVKGTYIKNIALTTTMGPSLKVKLPD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactatcaaaaaggatgcaagctgttaccaagctcattgataaaaacaaactt
tatcctatccaagaagcatttgaattaattaaaaaaacagcaattactaagtttgtcagt
tcagttgatattgctgttagtttaaaccttgatactactaaagctgaacaacagttaaga
ggtgcaattgcttttccttttagtattggtaaatctatcagaattttagctatcactgat
gatgagaaaaaagctagtgaagcaggtgctgattttgttggtgggcttgataagatagaa
gcgataaaaaatggctgattagattttgatctaattatcacttctcccaagttcatggga
gcattaggtaaactaggaaaactattaggaaccaggggattgatgccaaacccaaaaact
gaaacagttactgatgatgtagttagtgctattaaagcttataaaaagggtaagaaagaa
tatcgaactgattcatttggcaacatccacctctctttaggtaaaacagataccaaaact
gagcacttggttgctaatgccatggctttaatagatttaattaagtctaaacgtcctagc
acagtcaaaggtacttacattaaaaatattgctttgacaacaacaatgggaccaagttta
aaagtaaagctacctgattaa

DBGET integrated database retrieval system