KEGG   Mycoplasma genitalium G37: MG_086Help
Entry
MG_086            CDS       T00002                                 

Definition
(GenBank) prolipoprotein diacylglyceryl transferase
  KO
K13292  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase [EC:2.5.1.145]
Organism
mge  Mycoplasma genitalium G37
Brite
KEGG Orthology (KO) [BR:mge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MG_086
Enzymes [BR:mge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.145  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase
     MG_086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LGT Glycolytic
Motif
Other DBs
NCBI-ProteinID: AAC71304
UniProt: P47332
Position
112718..113866
Genome map
AA seq 382 aa AA seqDB search
MNRPSWSTAFNIGGGFPIQWYGIIVSIGIIFAILMFVFKLIYCYKLQDNSFYFFIFIAVL
TMVLGARLWSFVIGDSNFANNNFFDFRNGGLAIQGGILLTSIVGVIYFNFFLNSKTNKTK
TIAELLNNKNEIKAVYVERNISVLVMLDLIAPCVLIGQAIGRWGNFFNQEVYGFALAGTM
NDPQALANTQWGFLKILMPKVWDGMWIDGQFRIPLFLIESFFNTIFFVLIYFVMDFIRGV
KSGTIGFSYFLATGIIRLILENFRDQTFYFQTSITTSILFIVVGILGIFYCQFIHVKLRN
YFWTYFFLYAFYKVAAFFTTLFLNNRKQMAQQKFAFYEKSLPNKKRSFFEMKYYNDVTTP
KIYRLTDQEMKLFDKLEAVTTS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaccaagttgatcaactgcatttaatattggtggtggatttcccatccagtgg
tatgggatcattgtctcaattggcattatttttgccattttaatgtttgtctttaaactg
atttattgttacaaattacaagacaacagtttttatttttttatctttattgctgtttta
acgatggttttaggcgctcgcctctggtcatttgtaattggtgattccaattttgctaac
aacaatttctttgattttcgtaacggtggattggccattcagggtgggattttgttaacc
agtattgtcggagtaatctatttcaacttctttttaaatagtaagaccaataaaaccaaa
acgattgctgaattactgaataataagaatgaaataaaagctgtttatgttgaaagaaat
atctctgttctagtgatgttagatctgattgctccttgtgttttaattggtcaagcaatt
ggcagatggggtaattttttcaaccaagaagtttatgggtttgctttagctggaacaatg
aatgatccccaagcattggctaatacccagtggggatttttaaagatcttaatgcctaag
gtttgggatgggatgtggattgatggtcagtttcgcattccgctctttttaattgagtca
ttttttaacactattttctttgtgttaatttactttgtaatggattttattaggggagtt
aaaagtggcacaattggttttagttattttcttgctactggaatcattcgtttaatcttg
gaaaactttagagaccaaaccttttattttcaaacttcaataaccactagtattttgttt
attgtcgttggtattttaggaattttttattgccagtttatccatgtcaaattaagaaat
tacttctgaacttatttctttctttatgccttttataaagtagctgcttttttcactaca
ctttttttgaataacagaaagcaaatggcacaacagaagtttgctttttatgaaaaatca
cttcccaataagaagcgttctttttttgaaatgaagtattacaatgatgtaacaacaccc
aaaatttatcgtttaactgatcaggaaatgaagttatttgataaattagaggcagttaca
accagctag

DBGET integrated database retrieval system