KEGG   Mycoplasma genitalium G37: MG_088Help
Entry
MG_088            CDS       T00002                                 

Gene name
rpsG
Definition
(GenBank) ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
mge  Mycoplasma genitalium G37
Pathway
mge03010  Ribosome
Module
mge_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MG_088 (rpsG)
Ribosome [BR:mge03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    MG_088 (rpsG)
  Bacteria
    MG_088 (rpsG)
  Archaea
    MG_088 (rpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7 MMS19_C PsbQ AKAP7_NLS
Motif
Other DBs
NCBI-ProteinID: AAC71306
UniProt: P47334
Position
114331..114798
Genome map
AA seq 155 aa AA seqDB search
MRKNRALKRTVLPDPVFNNTLVTRIINVIMKDGKKGLAQRILYGAFEIIEKRTNQQPLTV
FEKAVDNVMPRLELKVRRIAGSNYQVPTEVPPDRRIALALRWIVIFANKRNEKTMLERVA
NEIIDAFNNTGASVKKKDDTHKMAEANKAFAHMRW
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatcgtgctttaaaaagaactgttttacccgatcctgtttttaacaacaca
ctggttacaaggattattaatgtcatcatgaaagatggcaagaagggtttagcacaacgc
atcttgtatggtgcttttgagatcattgaaaaacgcaccaaccaacaacctttaactgtc
tttgaaaaagcagttgataatgttatgccccgcttagagttaaaagtgagaagaattgct
ggttctaactaccaagtaccaactgaagttccccctgacagaaggattgctttagcacta
agatggattgtgatctttgctaacaaaagaaatgaaaaaacaatgcttgaacgtgttgct
aatgaaattattgatgcttttaataacacgggtgctagtgttaaaaagaaggatgatact
cacaagatggcagaagctaacaaagcctttgcccacatgcgttggtag

DBGET integrated database retrieval system